KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0115Help
Entry
COSY_0115         CDS       T00530                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COSY_0115 (ipk)
Enzymes [BR:vok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     COSY_0115 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(124722..125579)
Genome map
AA seq 285 aa AA seqDB search
MPSTWLAPAKINLFLHINKRRKDNYHNLQTIFQLLDYCDKLTCTITNNGVIKRTSGNKSV
KQDQDLIIKAAKALQQYTGTTLGANLSIVKNIPIGGGLGGGSSDAATTLVALNQLWDTKL
TQAQLMKLGLNLGADVPVFIFAQSAWAEGIGNILSPIKTPDHYFLVVFINKHISTKEIFS
HYALTISEPQGKIANFSELVNTHNDCLQVAIKLEAEIGVALEHLNTCYNRVGQARMSGTG
SCVFNEFLTEKDALAAAKKVPKKWMSFVTRAINNSPIYNWAVAKR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtacttggcttgcacctgcaaaaattaacttatttttgcacattaacaaacga
aggaaagataattaccacaacttacaaaccatcttccaactactggattattgtgataaa
ttaacttgtacaataactaataatggtgtcattaaacgtactagtggtaataaaagcgta
aaacaagatcaagatttaatcattaaagcagccaaagcacttcaacaatatactggaaca
acattaggtgccaatctctcaatcgttaaaaatattccaattggtggtggcttaggtggt
ggttcttcagatgcagcaactacgttagtagcacttaatcaactttgggatacaaaatta
actcaagcacaacttatgaagttaggtttaaatttaggtgcagatgtacctgtattcatt
tttgctcaaagcgcttgggcagaaggtataggaaatattctaagccctattaagacaccg
gatcattactttctagtagtttttattaacaaacacatttcaactaaagaaattttttct
cattatgcattgacaataagcgaacctcaagggaaaatagcaaacttttctgagcttgta
aacactcataatgattgtttacaggtggctataaaattagaagcagaaattggtgttgcg
ctagaacacctaaatacttgctataatcgtgtcggacaagctagaatgagtggaacagga
agctgtgtttttaatgaattcttaactgaaaaagatgccttggcagcggctaaaaaagtg
ccaaaaaaatggatgagttttgtaacacgtgcaatcaataattctcccatttacaattgg
gctgtcgccaagcggtaa

DBGET integrated database retrieval system