KEGG   Candidatus Vesicomyosocius okutanii: COSY_0348Help
Entry
COSY_0348         CDS       T00530                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vok  Candidatus Vesicomyosocius okutanii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vok03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(355980..356588)
Genome map
AA seq 202 aa AA seqDB search
MVMIGKLSGTILEKNPPEILLEVDKIGYEILCSMSSFYAMGDEEQLSLYTHLSIKENAHI
LYGFISKDEKTLFRELIRINGIGPKVALAILSHLDINSLIKVITDGNDTLLAKTPGIGIK
TAQKLIVELKDRLEKLKLNNENHKNIHIKFKKNPNIKQASAALQALGFKARESEKMLSVI
KDNSLSTKALIRQALQNKESFI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttggttatgattggtaaactttcaggcactattttagaaaaaaacccacctgaaatatta
cttgaagtagataaaattggctatgagattttatgctcaatgtcaagtttttatgcaatg
ggtgatgaagaacaactctcgttatacacccacttatcaatcaaagaaaacgcgcatatt
ttatacggttttatctctaaagatgaaaaaactttatttagagagttgattagaataaat
ggtattggtcctaaagtagcactagctattttatctcatcttgacattaattcactaata
aaagttattacagatggaaatgatactttactagcaaaaaccccaggaattggtataaaa
acagcacaaaaactcattgtagaacttaaagaccgtttagaaaaactaaaattaaacaat
gaaaatcataaaaatattcatataaaattcaaaaaaaatcctaatatcaaacaagcatca
gctgctttacaagcacttggatttaaagccagagaatctgaaaaaatgctatctgtcatt
aaagataactcactttcaactaaagcattaattcgacaagcactacaaaacaaagaatcc
tttatataa

DBGET integrated database retrieval system