KEGG   Candidatus Vesicomyosocius okutanii: COSY_0513Help
Entry
COSY_0513         CDS       T00530                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vok  Candidatus Vesicomyosocius okutanii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vok00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
539850..540461
Genome map
AA seq 203 aa AA seqDB search
MNNGVLFIISAPSGCGKTSLVKALIKKVENLCVSISHTTRQPRSGEIQGKNYFFVSKDEF
NKMKSSNNFIESTQVFDNNYGSSKQSVQDLLNSGFDVILEIDWRGFRQIKQTFSHSVGIF
ILPPSKVALEERLTNRGQDNKGIINRRMHDAVSEMQHFNEFNYLVINDNFDVALNNLSTI
VHAERLTLAQQSNKYQNLLKTLI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaataatggagtactattcattatttctgctccttcaggatgtggaaagacttcatta
gttaaagctctcattaaaaaagttgagaatttatgtgtttcaatttcacatactactaga
caaccccgttcaggtgaaatacaaggtaaaaactatttttttgtttctaaagacgagttt
aataaaatgaaaagtagtaacaattttattgaatctacccaagtatttgataataattat
ggcagctctaaacaatcagttcaagatttattaaatagtggatttgatgttattttagag
attgattggcgaggttttaggcagattaaacaaacttttagtcattcagtcggaatcttt
attctcccgccttctaaagtggcattagaagaacgtttaactaacagaggacaagataat
aaaggcatcattaatagaagaatgcatgatgcagtaagtgagatgcaacactttaatgaa
tttaactatttggttattaatgataactttgatgtagctctaaataatttatcaaccatc
gtacacgccgaacgcctgacgttagcacaacaatcaaacaaataccaaaatttacttaaa
acattaatttaa

DBGET integrated database retrieval system