KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0707Help
Entry
COSY_0707         CDS       T00530                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COSY_0707 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COSY_0707 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    COSY_0707 (thrC)
Enzymes [BR:vok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     COSY_0707 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739597..740661
Genome map
AA seq 354 aa AA seqDB search
MRYTGLIEYYKDRLPVNDNTKLISLGEGNTPLIQLVNLPKELSKDVDIYIKYEGLNPTGS
FKDRGMTMAVTKALESGSKAIICASTGNTSASAAAYAARAGIKAFVLIPEGKITLGKLAQ
AMMHSAIIIQIKGNFDDGMRLVKEVSEHVSVSIVNSINPFRLQGQKTAAFEIIEELGFAP
DYHCLPVGNAGNISSHCMGYSELYKEGKVNNMPKMIGYQAAGSAPFVKGIMIDNPETIAT
AIRIGHPQNWDLAQKVKKESKGWFSSLTDEKILSTQKLLSEREGIFCEPASATALAGAIH
DIKSGKIVNGSKIVCTLTGHGLKDSDTAISQCNNQIININPVISEVKNAIYNNM
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagatatacaggtttaattgaatactataaagatagactccctgtaaatgataatact
aaacttattagtttaggagaagggaatacaccacttattcagttggtaaatttacctaaa
gaattaagtaaagatgttgatatttatatcaaatatgaagggctaaatcctacaggttca
tttaaagatcgcggtatgactatggcagttactaaagctttagagtctggctctaaagca
attatttgcgcttctacaggcaatacttcagcatccgccgcggcttacgcagcacgtgct
ggtattaaagcgtttgtactaatccctgaaggtaaaattacactaggtaagttagcccaa
gcaatgatgcacagtgctattattattcaaatcaaaggtaactttgatgatggtatgcgt
ttggttaaagaagtatccgaacatgtctctgtatctattgtcaattcaattaatccgttt
cgtttacaaggtcaaaaaactgctgcctttgaaattatagaagaacttggatttgcacca
gattatcattgtctacctgttggaaatgcaggtaatatttcatcacattgcatgggatat
tcagaattatataaagaaggaaaagtaaacaatatgcctaaaatgataggctatcaagca
gcaggatctgcaccttttgttaaaggaattatgatagataaccctgaaactattgcaact
gctattcgtattgggcatcctcaaaactgggatttagcacaaaaagttaagaaagaatca
aaaggatggtttagctcattaactgatgaaaaaattttaagcacacaaaaattactttct
gaaagagaaggtattttctgcgaacctgcttcagcaaccgcactagcaggtgcaatccat
gatattaaaagcggtaaaattgtaaacggttctaaaatcgtatgtacactaacaggtcat
ggtttaaaagactctgatacagcaatttcacaatgcaataatcaaataatcaatattaac
ccagtaataagtgaagttaaaaacgctatttacaacaatatgtaa

DBGET integrated database retrieval system