KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0756Help
Entry
COSY_0756         CDS       T00530                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01130  Biosynthesis of antibiotics
vok01230  Biosynthesis of amino acids
Module
vok_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COSY_0756
Enzymes [BR:vok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     COSY_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAF61864
UniProt: A5CW14
Position
795875..796681
Genome map
AA seq 268 aa AA seqDB search
MMNTPDILKKIIARKKVEIAECKNNIPENQMLDVAYKNHNTNNFYQALKDKVDTKQNAII
AEIKKASPSKGVLRENFNPVEIAESYEKSGATCLSVVTNKDFFQGNNQHLIDVCEAISIP
ILHKEFIIDSYQIYESRTLGADCILLIAACLNDQQIEDFTMQAININMDVLIEIHNIEEL
ERTLQLRLPMIGVNNRNLHTFDVSLETTIELMKEIKEDTLIITESGILTSNDVAFMNKHN
IYSFLVGEAFMRQDNPGKALQKIFGKNK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatacacctgatattttaaagaaaattattgcacgtaaaaaagttgaaattgca
gaatgtaaaaataatattccagaaaaccagatgctggatgttgcgtataaaaaccataat
acaaataacttttaccaagcattgaaagataaagtagatacaaagcaaaatgccattatt
gcagaaatcaaaaaagcatctccttctaaaggtgtgttacgtgaaaatttcaaccctgtt
gaaatagccgaaagctacgaaaaatcaggtgcaacttgcttatcagttgtaaccaataaa
gacttcttccaagggaacaatcaacacttaattgatgtatgcgaagcaatatcaataccc
atcttacacaaagaatttattatagactcttatcagatttacgaatctagaaccttaggt
gctgattgtattttactaattgccgcttgcctaaatgatcaacaaatagaagactttaca
atgcaagccattaacattaatatggatgttttgattgagatacacaatatagaagaatta
gaacgtacattgcaattgcgcctgccaatgattggtgttaataatagaaacttacacacc
tttgatgtttccttagaaacaactattgaactgatgaaagaaatcaaagaagatactttg
attattactgaaagcggtatcctaacttcaaatgatgttgcttttatgaataagcataat
atttacagctttttggttggcgaagcgtttatgcgtcaagataatccaggaaaagcacta
cagaaaatttttggaaagaataaatga

DBGET integrated database retrieval system