KEGG   Candidatus Vesicomyosocius okutanii: COSY_0801Help
Entry
COSY_0801         CDS       T00530                                 

Gene name
carA
Definition
carbamoyl-phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
vok  Candidatus Vesicomyosocius okutanii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vok00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vok00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(836326..837447)
Genome map
AA seq 373 aa AA seqDB search
MLQVALLALEDGKIFYGKSIGVNGITLGEVVFNTSMTGYQEILTDPSYVQQIVILTCPHI
GNTGINLVDEESDKIHVSGLIIRDLSLIASNWRSDISLGAYLKHNNIVAISDIDTRALTR
HLRKQGSLKGCIITGNDIDPEVAIAKAKLFVGMKNIDLAKVVSTTQSYEFNQGSYSLVNT
KFNELNTKFKVVVYDFGVKKNILKMLVDKGCALTVVNAQTSATKVLERNPDGVFLSNGPG
DPEPCDYAIKNIQILLGKDIPLFGICLGHQLLSLAVGATTQKMKFGHHGANHPVQNLHTK
QVIITSQNHGFVVSDENMPNDLEVTHRSLFDNSIQGIHIVNKKAFGFQGHPEASPGPHDM
SSFFDTFIREMNE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgttacaagttgctttattagcattagaagatgggaaaattttttatggaaagtctatt
ggtgttaatggtataactttgggtgaagtagtgtttaatacttcaatgacaggctatcaa
gaaattttaacggatccatcatatgtacaacaaatcgtcatattaacttgtccacatatt
ggtaatacaggtattaatttagttgacgaagagtctgataaaattcatgtatctgggttg
attattcgagatttatctttaatagcgagtaattggcgttcagatatatctttaggtgct
tatttaaagcataataatattgttgctattagcgatattgatacacgtgcgttaacgcgc
catttgcgtaaacaaggatcacttaaaggttgtattattacaggtaatgatattgaccca
gaagtagctattgctaaggctaaattatttgttggtatgaaaaatatagatttagcaaaa
gtagtttccactactcaatcttatgaatttaatcaaggttcttattcgttagtaaatact
aagtttaatgagttaaataccaaatttaaagtggtggtttatgattttggagtaaagaaa
aatatcttaaaaatgttggtagataaggggtgtgcattgactgttgttaatgcacaaaca
tcagcgactaaagtattggaaagaaatcctgatggcgtatttttatctaatggaccaggt
gatcctgagccatgcgattatgctattaaaaatattcagattttattgggaaaagatata
ccattatttggtatttgtttaggtcatcaattattatccttggcagttggtgcaacaacg
caaaagatgaaatttggtcatcatggtgctaaccatcctgttcaaaatttacatactaaa
caagtgataataacttctcaaaatcatggatttgtggtgtcagatgaaaatatgcccaat
gatttagaagtaacacatcgttcgttatttgataattctattcaaggtattcatattgtt
aataaaaaagcatttggttttcaagggcatcctgaagcttcgccaggcccgcatgatatg
agtagtttttttgatacatttattagggaaatgaacgaatga

DBGET integrated database retrieval system