KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0811Help
Entry
COSY_0811         CDS       T00530                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00040  Pentose and glucuronate interconversions
vok00052  Galactose metabolism
vok00500  Starch and sucrose metabolism
vok00520  Amino sugar and nucleotide sugar metabolism
vok01100  Metabolic pathways
vok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COSY_0811 (galU)
   00052 Galactose metabolism
    COSY_0811 (galU)
   00500 Starch and sucrose metabolism
    COSY_0811 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    COSY_0811 (galU)
Enzymes [BR:vok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     COSY_0811 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD DUF2759
Motif
Other DBs
NCBI-ProteinID: BAF61917
UniProt: A5CVU5
Position
847525..848358
Genome map
AA seq 277 aa AA seqDB search
MIKKCLFPAAGLGTRFLPATKAVPKEMLPILTKPLLQYAVEEALSANITNIAIVTNKNKR
AIEDHFDQALELELQIKGTQKEELLKEINTVCNYATFTYVRQKQMLGLGYAILTGKALIG
NEPFAVHLADDLCTSEEGNSVLYQMIKIYNKYQCSIVAIEEVPMNQIHKYGVIVGDLIDN
TNNTYRVTNMVEKPTPKNAPTNMAIIGRYILTPDIFNILKQTKPDKGGEIQITDALLTQS
KQGNVIAYKFKGKRFDCGSIQGYIKATNYFAKLQGIM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgcagcaggattaggtactagatttttacccgccaca
aaagcagttcccaaagaaatgttacctattttaactaaaccgttattgcaatacgctgta
gaagaagcacttagtgctaatataaccaatatagccatcgtaactaataaaaacaaacga
gctatcgaagaccattttgatcaagctttggaattggagttgcaaattaaaggaacgcaa
aaagaggaactactaaaagagatcaataccgtttgcaactatgctacattcacttatgtc
agacaaaaacaaatgttaggattaggatatgcaattctcactggtaaagcactaattggt
aatgaaccttttgctgttcatctagccgatgacttatgcacatcagaagaaggcaatagt
gtactatatcaaatgattaaaatatacaacaaatatcaatgttcaatagtagctatcgaa
gaagtacctatgaatcaaattcataagtatggtgtgattgttggtgacttgattgataat
actaataatacgtatcgagttactaatatggttgaaaaaccaacaccaaaaaatgcacca
actaacatggctattataggtcgttatatcttaacgccagatatttttaatatccttaaa
caaactaaaccagacaaaggtggtgaaattcaaattaccgatgcactacttactcaatca
aaacaaggtaacgttattgcctataaatttaaaggaaaacgttttgattgtggtagtatt
cagggctacattaaagcaacaaactattttgctaaactacaaggtatcatgtaa

DBGET integrated database retrieval system