KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0865Help
Entry
COSY_0865         CDS       T00530                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Brite
Enzymes [BR:vok01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     COSY_0865 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_32 Methyltransf_18 NodS Methyltransf_12 Ubie_methyltran MTS Methyltransf_4 PrmA CMAS Methyltr_RsmB-F Spermine_synth TehB Cons_hypoth95 DUF938
Motif
Other DBs
NCBI-ProteinID: BAF61970
UniProt: A5CVP3
Position
898299..898952
Genome map
AA seq 217 aa AA seqDB search
MNIKQARKNVIEQQIRPWGGLNYIANNALKDTPREDFVPEKYKNLTFADIEIPLTSKAKM
LFPKIEGRLLNALNIKKHETVLEIGTGSGYLTAVLSKLCKSVTSIEIDENLSHNAKKRID
TLGIDNVTLEVVDASKNWKYNDFFNVVIISSSVPKITGYYFHLLNIGGRIFVIEGTKNIM
SAKLITRISKNKWDTKSLFETQLDAMRGLESSNNFEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaacaagcaagaaaaaatgtcattgaacaacaaatacgcccttggggcggc
ttgaattatattgctaataatgcacttaaagatacaccaagagaagattttgtaccagag
aaatataaaaatcttacatttgcagatattgaaattccacttactagtaaagcaaaaatg
ctttttccaaagattgaaggacgattattaaatgcacttaatattaaaaaacatgaaact
gtactagagataggaacaggtagtggttatttaacagctgttttatcaaaattatgcaaa
tctgtaaccagtattgaaattgatgaaaatcttagtcataatgccaaaaaaagaattgat
acattgggcattgataatgttactttagaagtggtagatgcttctaagaactggaagtat
aatgatttctttaatgtagtaattattagtagttcagtacctaaaattacaggttattac
tttcatttattaaatataggtggtagaatttttgtgattgaaggtactaaaaacattatg
agtgcaaaacttattactcgaattagtaagaataaatgggatacaaaatccttatttgaa
acacaattagacgccatgcgaggattagaatcatcaaataattttgaattttaa

DBGET integrated database retrieval system