KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0933Help
Entry
COSY_0933         CDS       T00530                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COSY_0933 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COSY_0933 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COSY_0933 (trpB)
Enzymes [BR:vok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COSY_0933 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(977043..978248)
Genome map
AA seq 401 aa AA seqDB search
MSNYNLPDDNGHFDKYGGIFIAETLMTAVFELKDAYARFKNDSKFICEFEQDLKHYAGRE
TPLYYAKNLSKKLRGAQIYLKREDLNHTGSHKINNTIGQALLAKRMGKTRIIAETGAGQH
GVATATVAARLGLECVVYMGEVDVARQSLNVFRMKLLGAKVIPVTSGSKTLKDSLNEAMR
DWVKNIDDTFYIIGTIAGPHPYPMMVRDFQSIIGKEAKAQFHDQVGGLPDALVACVGGGS
NAIGLFYAFIDNVSVEIYGVEAAGHGLEKGPSAHAAPLCAGNVGVLHGNRTYLMGDENGQ
IIEGHSIAAGLDYPGVGPEHAYLKDSGRAQYMAITDKEALEAFHILTKIEGILPALESSH
AVAYGIKLAKKLGKNKSIIINLSGRGDKDIHTIAQIEGIEC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattataatttaccagatgataatggtcattttgataagtatggtggtattttt
attgcggaaacgcttatgacagctgtttttgaactcaaagatgcttatgctagatttaaa
aatgattctaaatttatttgtgaatttgagcaggatttaaagcattatgctggtcgtgaa
acgccactttattatgcgaaaaatttaagcaaaaagttgagaggagctcaaatctatctt
aaacgtgaagatttaaatcatacaggttcgcataaaattaataatactattggtcaagca
ttacttgctaagcgtatggggaaaacacgtattattgctgaaacaggtgctggtcagcac
ggggtagcaacggcaacggttgcagcgcgtttaggcttggagtgtgtggtttatatgggt
gaggtagatgtagctcgacaatctctgaatgtatttcgaatgaagttattaggcgctaag
gttattccagttacttcaggttcaaaaacacttaaagactctcttaatgaagcaatgcgt
gactgggtgaagaatattgatgatacgttttatattattggcacaatagcgggtccacat
ccttatccaatgatggtgcgagattttcaaagtattattggtaaagaagcaaaagcacaa
tttcatgatcaggtaggtggtttaccagatgctttggtggcttgtgtgggtggtggttca
aatgcgattggtttattctatgcatttattgataacgtttcagttgagatttatggtgtt
gaagcagcaggacatggcttggaaaaaggtccaagtgcacatgctgccccactttgtgca
ggtaatgtgggtgtgttacatggtaatcgaacttatttaatgggagatgagaatgggcaa
attattgaggggcattcaattgcagcaggtcttgactatccaggggttgggcctgaacat
gcgtatttaaaagatagtggccgtgcacaatatatggcgattactgataaagaagcatta
gaagcatttcatatacttactaaaattgagggtattttaccagcattagaatcttcccac
gctgtggcttatggtatcaagcttgcaaaaaaattaggtaaaaataaaagtattattatt
aacctttctggtcgtggtgataaggatatccacactattgcacaaattgaaggtattgaa
tgttaa

DBGET integrated database retrieval system