KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0933Help
Entry
COSY_0933         CDS       T00530                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00260  Glycine, serine and threonine metabolism
vok00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01130  Biosynthesis of antibiotics
vok01230  Biosynthesis of amino acids
Module
vok_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COSY_0933 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COSY_0933 (trpB)
Enzymes [BR:vok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COSY_0933 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAF62032
UniProt: A5CVH4
Position
complement(977043..978248)
Genome map
AA seq 401 aa AA seqDB search
MSNYNLPDDNGHFDKYGGIFIAETLMTAVFELKDAYARFKNDSKFICEFEQDLKHYAGRE
TPLYYAKNLSKKLRGAQIYLKREDLNHTGSHKINNTIGQALLAKRMGKTRIIAETGAGQH
GVATATVAARLGLECVVYMGEVDVARQSLNVFRMKLLGAKVIPVTSGSKTLKDSLNEAMR
DWVKNIDDTFYIIGTIAGPHPYPMMVRDFQSIIGKEAKAQFHDQVGGLPDALVACVGGGS
NAIGLFYAFIDNVSVEIYGVEAAGHGLEKGPSAHAAPLCAGNVGVLHGNRTYLMGDENGQ
IIEGHSIAAGLDYPGVGPEHAYLKDSGRAQYMAITDKEALEAFHILTKIEGILPALESSH
AVAYGIKLAKKLGKNKSIIINLSGRGDKDIHTIAQIEGIEC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattataatttaccagatgataatggtcattttgataagtatggtggtattttt
attgcggaaacgcttatgacagctgtttttgaactcaaagatgcttatgctagatttaaa
aatgattctaaatttatttgtgaatttgagcaggatttaaagcattatgctggtcgtgaa
acgccactttattatgcgaaaaatttaagcaaaaagttgagaggagctcaaatctatctt
aaacgtgaagatttaaatcatacaggttcgcataaaattaataatactattggtcaagca
ttacttgctaagcgtatggggaaaacacgtattattgctgaaacaggtgctggtcagcac
ggggtagcaacggcaacggttgcagcgcgtttaggcttggagtgtgtggtttatatgggt
gaggtagatgtagctcgacaatctctgaatgtatttcgaatgaagttattaggcgctaag
gttattccagttacttcaggttcaaaaacacttaaagactctcttaatgaagcaatgcgt
gactgggtgaagaatattgatgatacgttttatattattggcacaatagcgggtccacat
ccttatccaatgatggtgcgagattttcaaagtattattggtaaagaagcaaaagcacaa
tttcatgatcaggtaggtggtttaccagatgctttggtggcttgtgtgggtggtggttca
aatgcgattggtttattctatgcatttattgataacgtttcagttgagatttatggtgtt
gaagcagcaggacatggcttggaaaaaggtccaagtgcacatgctgccccactttgtgca
ggtaatgtgggtgtgttacatggtaatcgaacttatttaatgggagatgagaatgggcaa
attattgaggggcattcaattgcagcaggtcttgactatccaggggttgggcctgaacat
gcgtatttaaaagatagtggccgtgcacaatatatggcgattactgataaagaagcatta
gaagcatttcatatacttactaaaattgagggtattttaccagcattagaatcttcccac
gctgtggcttatggtatcaagcttgcaaaaaaattaggtaaaaataaaagtattattatt
aacctttctggtcgtggtgataaggatatccacactattgcacaaattgaaggtattgaa
tgttaa

DBGET integrated database retrieval system