KEGG   Candidatus Vesicomyosocius okutanii: COSY_0977Help
Entry
COSY_0977         CDS       T00530                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COSY_0977 (tpiA)
   01230 Biosynthesis of amino acids
    COSY_0977 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COSY_0977 (tpiA)
   00051 Fructose and mannose metabolism
    COSY_0977 (tpiA)
   00562 Inositol phosphate metabolism
    COSY_0977 (tpiA)
Enzymes [BR:vok01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COSY_0977 (tpiA)
Exosome [BR:vok04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COSY_0977 (tpiA)
  Exosomal proteins of bladder cancer cells
   COSY_0977 (tpiA)
  Exosomal proteins of melanoma cells
   COSY_0977 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1020753..1021499)
Genome map
AA seq 248 aa AA seqDB search
MRQVIIAGNWKMNASKEATNILVMDILSGMVDVKSKVIICVPFPYMAQVEALVGCSQLNL
GAQDLNINKSGAFTGEVSVDMIKDFGARYVIVGHSERRSLYFENNEIVAQKVQVALNNNL
TPLLCIGELLEDRDSGKTQEVVSEQIQAVIDLVGIDAFKDIIVAYEPVWAIGTGITATPQ
QAQDTHAFIRSMLAKYDDNVSQITSILYGGSMNPRNAAELMNCKDIDGGLIGGASLKAQD
FLQICKAS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaagtaatcatagcaggtaactggaaaatgaatgcttctaaagaagcaactaac
atattagtaatggatattttatctggtatggtagatgttaaatctaaggtaattatttgt
gtaccttttccttatatggcacaggttgaagcattagttggttgttcacaactaaattta
ggcgcacaagatttgaatattaataaatcaggtgcttttacaggtgaagttagtgttgat
atgattaaagattttggtgctcgatatgttattgtaggtcactcagaacgcagaagtctt
tattttgaaaataatgagattgttgcacaaaaagttcaagttgcattgaataataactta
actccacttttgtgtattggagaattattagaagatagagattctggcaagactcaggaa
gtggtttcagaacaaattcaagcggtaattgatttggttggtattgatgcgtttaaagat
attattgtggcttatgaaccagtttgggcaattggtacaggtattactgcaacacctcag
caagcacaagatacacatgcttttattcgttcaatgcttgctaaatatgatgataatgtt
tcacaaattacttcgattctttatggcggtagtatgaatcctagaaatgcagctgaatta
atgaattgtaaagatattgacgggggattaattgggggggcttcacttaaagcgcaagat
ttcttacaaatttgtaaggctagttaa

DBGET integrated database retrieval system