KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0977Help
Entry
COSY_0977         CDS       T00530                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Pathway
vok00010  Glycolysis / Gluconeogenesis
vok00051  Fructose and mannose metabolism
vok00562  Inositol phosphate metabolism
vok01100  Metabolic pathways
vok01110  Biosynthesis of secondary metabolites
vok01120  Microbial metabolism in diverse environments
vok01130  Biosynthesis of antibiotics
vok01200  Carbon metabolism
vok01230  Biosynthesis of amino acids
Module
vok_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vok00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COSY_0977 (tpiA)
   00051 Fructose and mannose metabolism
    COSY_0977 (tpiA)
   00562 Inositol phosphate metabolism
    COSY_0977 (tpiA)
Enzymes [BR:vok01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COSY_0977 (tpiA)
Exosome [BR:vok04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COSY_0977 (tpiA)
  Exosomal proteins of bladder cancer cells
   COSY_0977 (tpiA)
  Exosomal proteins of melanoma cells
   COSY_0977 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAF62075
UniProt: A5CVF7
Position
complement(1020753..1021499)
Genome map
AA seq 248 aa AA seqDB search
MRQVIIAGNWKMNASKEATNILVMDILSGMVDVKSKVIICVPFPYMAQVEALVGCSQLNL
GAQDLNINKSGAFTGEVSVDMIKDFGARYVIVGHSERRSLYFENNEIVAQKVQVALNNNL
TPLLCIGELLEDRDSGKTQEVVSEQIQAVIDLVGIDAFKDIIVAYEPVWAIGTGITATPQ
QAQDTHAFIRSMLAKYDDNVSQITSILYGGSMNPRNAAELMNCKDIDGGLIGGASLKAQD
FLQICKAS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaagtaatcatagcaggtaactggaaaatgaatgcttctaaagaagcaactaac
atattagtaatggatattttatctggtatggtagatgttaaatctaaggtaattatttgt
gtaccttttccttatatggcacaggttgaagcattagttggttgttcacaactaaattta
ggcgcacaagatttgaatattaataaatcaggtgcttttacaggtgaagttagtgttgat
atgattaaagattttggtgctcgatatgttattgtaggtcactcagaacgcagaagtctt
tattttgaaaataatgagattgttgcacaaaaagttcaagttgcattgaataataactta
actccacttttgtgtattggagaattattagaagatagagattctggcaagactcaggaa
gtggtttcagaacaaattcaagcggtaattgatttggttggtattgatgcgtttaaagat
attattgtggcttatgaaccagtttgggcaattggtacaggtattactgcaacacctcag
caagcacaagatacacatgcttttattcgttcaatgcttgctaaatatgatgataatgtt
tcacaaattacttcgattctttatggcggtagtatgaatcctagaaatgcagctgaatta
atgaattgtaaagatattgacgggggattaattgggggggcttcacttaaagcgcaagat
ttcttacaaatttgtaaggctagttaa

DBGET integrated database retrieval system