KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0030Help
Entry
VP0030            CDS       T00120                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VP0030 (fadB)
   01212 Fatty acid metabolism
    VP0030 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VP0030 (fadB)
   00650 Butanoate metabolism
    VP0030 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VP0030 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VP0030 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VP0030 (fadB)
   00310 Lysine degradation
    VP0030 (fadB)
   00380 Tryptophan metabolism
    VP0030 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VP0030 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VP0030 (fadB)
   00281 Geraniol degradation
    VP0030 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VP0030 (fadB)
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VP0030 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VP0030 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VP0030 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VP0030 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(28083..30254)
Genome map
AA seq 723 aa AA seqDB search
MIYQADTLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALTSHQGLKGLMLTSD
KDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
IGLLDAVVETDALYESALQTLTSAINEKIDWQARRKQKTSPLTLSKLESMMSFTMAKGLV
AQVAGPHYPAPMTAVITIEEGARFARNEALDIERKYFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSASKDTERAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEASKL
LNKRLAQGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKATVLSEVESHVG
EDTVITSNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKVDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEANKYGQKNGNGFYSYTIDKKGK
PKKTFTEDILPVLADVCADKQEFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEFVEMAKQHADLGAMYHVPQMLIDMAAKGESFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgacaccctacaggtaaaggaaatacaagatggcatagcagagctg
agcttctgctcccctaaatccgtaaacaagctcgacctagcaacgctagagtctctcgat
aaggctcttgatgcgttgacttcacatcaaggtctaaagggcttaatgctcacttcagat
aaagatgcgttcatcgttggcgcagacatcactgaattcttgggcctcttcgctaaaaca
gacgccgagctcgatcaatggctacaatttgccaatagcatcttcaataaactagaagac
ttacccgttccgacaatctcagtacttaaaggtcacacacttggcggcggctgcgaatgc
gtactggctaccgacatgcgtatcggtgataaaaccaccagcattggcctaccagaaacc
aaacttggcatcatgcctggctttggcggttgtgtgcgtttgccgcgtgttatcggtgca
gatagcgcgatggaaatcatcacgcaaggcaaagcatgtcgtgcagatgaagcattgaag
attggtttattggatgctgtggttgaaactgatgcgttgtatgaatccgcattgcaaaca
ctgacttcagctatcaacgaaaagatcgattggcaagcacgtcgtaaacaaaaaacctcg
ccactgacactcagcaagctagagtcgatgatgagcttcacgatggcaaaaggcctagtg
gcacaagtagccggtccacactaccctgcgccaatgacagccgttatcacgattgaagaa
ggcgcacgctttgcgcgtaacgaagcactcgacattgaacgcaaatacttcgttaaactc
gcgaaatcagaagaagccaaagctctggttggtctgttcctcaacgaccaatacatcaaa
ggcatcgcgaaaaaagcggcgaaatcagcaagcaaagacactgagcgagcagcggtatta
ggtgcaggcatcatgggtggtggcatcgcttaccaatctgcgctgaaaggcgtgccagta
ttgatgaaagacatcgcccaaccatctctcgatttaggcatgaccgaagcgtctaaactg
ctgaacaaacgccttgctcaaggtcgtatcgacggcttcaagatggcgggaattttggca
tcaattaccccaagcctacattacgcaggcatcgaaaactcagatgtgattgttgaagcc
gttgtcgaaaatccaaaagtaaaagcaacggtactgagcgaagtcgaatcgcacgttggt
gaagacaccgtcattacatcaaacacatcgacgattccaatcaacctattggcacaatca
cttaaacgcccagaaaatttctgtggtatgcacttctttaaccctgtgcatcgcatgcct
ttggttgaaatcatccgtggtgagaaaacttctgatgaaaccatcaaccgcgtagtggct
tacgcagcgaaaatgggtaaatccccaatcgtcgtgaacgactgtccgggattcttcgtc
aaccgcgtattattcccgtactttggcggtttcagcatgttgcttcgtgacggtgcagac
ttcactaaagtcgacaaagtcatggaacgcaaatttggctggccgatgggcccggcgtac
ttgcttgatgtagtcggcatcgatactgcgcaccacgcacaagcggtgatggcagaaggt
ttccctgagcgaatgggtaaacaaggtcgtgacgcgattgatgctctattcgaagccaac
aaatacggtcagaagaatggcaacggtttctatagctacaccattgataaaaaaggtaag
cctaagaaaaccttcactgaagatatcttgccagtactggcagacgtctgcgcggataaa
caagagttcgatgagcagaccatcatccaacgtatgatgattccgatgatcaacgaagtg
gtgctgtgtctgcaagaaggcattattgcaacgcctcaagaagcagatatggcgctggtt
tacggccttggtttccctccattccgcggcggtgtattccgctacctagacagcgtaggt
attgctgaatttgttgaaatggcaaaacagcacgctgatctaggcgcgatgtaccatgtt
ccgcaaatgttgattgatatggcggcgaaaggcgaaagcttctacggcgcgcaacagcaa
ggttctatctaa

DBGET integrated database retrieval system