KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0237Help
Entry
VP0237            CDS       T00120                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VP0237
   00052 Galactose metabolism
    VP0237
   00500 Starch and sucrose metabolism
    VP0237
   00520 Amino sugar and nucleotide sugar metabolism
    VP0237
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VP0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:250898..251776
Genome map
AA seq 292 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIEAGMNGMCIVTGRGKH
SLMDHFDKNYELEHQISGTSKEALLDDIRSLIDSASYTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEQGVLAQMVELYKQFRCSIVAVQEVPETETHKYGVIAGEMIKDD
IFRIDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALMQQAQSG
CVIAYKFKGQRFDCGSVEGYIEATNYCYENLYKKASSAELAKTPTVKVSEPA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgcagcaggctacggtactcgttttctacctgcaaca
aaatccatgcccaaagaaatgatgccggtagttaacaagccattgattgaatatggtgtt
gaagaagcgattgaagctggcatgaatggtatgtgtattgtcactggtcgtggcaaacac
tcattgatggatcactttgataaaaactacgagttggaacatcaaatctcaggcacaagt
aaagaagcactgctggacgatatccgctctttgattgattcagcgagttacacatatatc
cgtcaacgtgagatgaaaggtcttggtcatgctatcttgactggtcgtgagttggtgggt
gatgagccatttgctgttgtgctagcagacgatctttgtgtgaatgaagagcagggcgta
ttagcgcaaatggtcgagctgtacaagcagttccgttgctctattgttgcggttcaagaa
gttccagaaactgaaactcataaatatggtgtaattgccggtgagatgatcaaagatgac
atcttccgaattgataacatggtagagaagccagaaccaggcacagcaccaagtaactta
gctattattggtcgctatatcttaacgccagatatttttgagcttatcgaaaatacagaa
ccaggcaaaggtggagaaatccaaatcactgacgcattgatgcaacaagcgcaatctggt
tgtgttattgcttacaaatttaaaggtcagcgttttgactgcggcagtgtagaaggttac
atcgaggcgacaaactactgctacgagaacctatacaaaaaagcgtctagtgctgagctt
gctaaaacaccaaccgtgaaggtttctgaaccagcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system