KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0239Help
Entry
VP0239            CDS       T00120                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VP0239 (tpiA)
   01230 Biosynthesis of amino acids
    VP0239 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VP0239 (tpiA)
   00051 Fructose and mannose metabolism
    VP0239 (tpiA)
   00562 Inositol phosphate metabolism
    VP0239 (tpiA)
Enzymes [BR:vpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VP0239 (tpiA)
Exosome [BR:vpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VP0239 (tpiA)
  Exosomal proteins of bladder cancer cells
   VP0239 (tpiA)
  Exosomal proteins of melanoma cells
   VP0239 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(253572..254342)
Genome map
AA seq 256 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTELLTGLNAELEGVEGVDVAVAPPALYIDLAERLIAEGGNK
IILGAQNTDLNNSGAFTGDMSPEMLKDFGATHIIIGHSERREYHNESDEFIAKKFNFLKE
NGLTPVFCIGESEAQNEAGETEAVCARQINAVIDTYGVEALNGAIIAYEPIWAIGTGKAA
TAEDAQRIHASIRALIAAKDEAVAAQVIIQYGGSVKPENAEAYFSQPDIDGALVGGASLD
AKSFAAIAKAAAAAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgtagtgatgggtaactggaaactaaacggcagcaaagcaatggtaact
gagctgctaactggtcttaacgctgagcttgaaggcgttgaaggtgttgacgtagcagta
gctccaccagcactttacatcgacctagctgagcgtctaatcgctgaaggcggtaacaag
atcatcctaggtgctcaaaacactgacctaaacaacagcggtgctttcactggcgacatg
tctccagaaatgctgaaagatttcggtgcaactcacatcatcatcggtcactcagagcgt
cgtgaataccacaacgaatctgacgagttcatcgctaagaaattcaacttcctaaaagaa
aacggtctaacgcctgttttctgtatcggtgaatctgaagctcaaaacgaagctggcgaa
actgaagcagtatgtgcacgtcaaatcaacgcagttatcgacacttacggtgttgaagct
ctaaacggcgcaatcatcgcttacgaaccaatctgggctatcggtactggtaaagcagca
acagctgaagatgcacaacgcatccatgcttctatccgcgcactaatcgcagcgaaagac
gaagcagttgcagcacaagtaatcatccaatacggcggttctgttaagccagaaaacgct
gaagcttacttctcacaaccagacatcgacggtgctctagttggcggcgcttctctagac
gctaagagcttcgcagcaatcgctaaagcagcggcagcagctaaagcttaa

DBGET integrated database retrieval system