KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0333Help
Entry
VP0333            CDS       T00120                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VP0333
   00670 One carbon pool by folate
    VP0333
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VP0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:326753..327235
Genome map
AA seq 160 aa AA seqDB search
MIISMIAAMADNRVIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYDSIGRPLPGRLN
IVISRDESLSIEGVTTVTSVEKALEAAGDVEEVMIIGGGAIYASCLAMANKLYVTHIDAV
VEGDTQFPDWGNEFKETYSETYQADEKNAYNMRFTILEKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagtatgattgccgcgatggcagacaaccgcgttattggcaaagataatcaa
atgccttggcatcttcctgcggattttgcttggtttaaacgttgtacgatggggaagccc
gtcgtaatgggaagaaagacttacgattcaattggtcgccctttgccaggacgtttgaat
attgtcattagccgagatgaatcattgagtattgaaggcgttacgacggtgacttcagtt
gaaaaagcgttagaggctgcaggtgatgttgaagaagtaatgatcattggtggcggtgct
atctatgcttcttgtttagcgatggcaaataaactgtacgtcacacatattgatgctgta
gttgaaggtgacacccagttcccagactggggtaatgagttcaaagagacatattctgaa
acctaccaagcggatgagaaaaacgcttacaacatgcgttttacgattttagaaaagcaa
tag

DBGET integrated database retrieval system