KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0510Help
Entry
VP0510            CDS       T00120                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VP0510
Secretion system [BR:vpa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VP0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:525615..526403
Genome map
AA seq 262 aa AA seqDB search
MSVLRRLTLLTLPFFITVCGAEESQAKTETPAQQAAPTAQQHFDEAALKAKFSKLGLSII
DIQPSDVAGLLEIQTNGGILFASNNGDHFIAGTLYAIDDNGGYKDVLAERQAPLNAEKIA
EFADSMIEYKADNEKYVVTVFTDITCGYCVRLHNQMQGYNDLGITVRYMAYPRQGATGPV
AEQMATIWCAEDPKAAMHNAKVSRTFDNPAKDLEQCKETIQAHYNVGRQLGISGTPAIFL
PNGEMVGGYLPPAELLKRLEQL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccgactaactctgctgactttaccattctttattaccgtgtgtggt
gcggaagaaagtcaggcaaaaaccgaaactcctgcacaacaggctgcgccaactgcgcaa
caacactttgatgaagcggcgctaaaagcgaagttctcgaaactaggtctgtctattatt
gatattcaaccttcagacgtggcgggcttgctagaaattcaaaccaacggcggcatattg
tttgcgtcaaacaatggcgatcactttattgctggtacgctatacgcgattgatgacaac
ggcggttacaaagacgtacttgcagaacgccaagcgcctttgaatgctgagaaaattgcc
gagtttgcagacagcatgatcgaatacaaagcggacaacgaaaagtacgtggtgacggta
tttactgacatcacttgtggctactgtgttcgtctacataaccaaatgcagggctacaat
gatctaggtattactgtgcgttacatggcataccctcgccaaggtgcgacagggcctgtt
gctgagcaaatggcaacgatttggtgtgcagaagatccaaaagcggcgatgcataacgcg
aaagtgagccgaactttcgataatccagcgaaagatcttgagcaatgtaaagagaccatt
caagcgcactacaacgttggtcgtcagttaggtatttcaggtacgcctgcaatcttcctt
ccaaacggtgagatggttggtgggtacttaccgccagctgaactactgaaacgtttagag
caactgtaa

DBGET integrated database retrieval system