KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0545Help
Entry
VP0545            CDS       T00120                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VP0545
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VP0545
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VP0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:562039..563022
Genome map
AA seq 327 aa AA seqDB search
MGPLWVDVAGYELTAEDKEILEHPTVGGLILFTRNYHDSEQLQALTQSIRKAVKRPFLIG
VDQEGGRVQRFREGFSLIPAADEYAKHHNGEELARMGGWLMAAELIAHDIDLSFAPVLDK
GHQCKAIGNRSFGEDADTILRYSTAYMQGMKSVGMATTGKHFPGHGGVIADSHLETPYDE
RSDIFEQDMAIFKAQIDAGILDAMMPAHVIFPNYDSQPASGSEYWLKHVLRQKLGFKGLI
FSDDLTMEGAAIMGSPAERGAQAMKAGCDMLLMCNKREAQVEVLDNLPVSTVPLADALLK
KQSFSLSDLKLSHEWKAASEAMKRLTS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgttatgggttgacgttgcgggttatgaactgaccgcagaagacaaagaaatt
ctggaacatcctacggttggtggcttgatcctatttactcgtaactatcatgatagtgaa
cagcttcaagcacttactcaatctatccgcaaagctgtgaaacgcccattcctgattggt
gtggatcaagagggcgggcgagtacaacgctttcgtgaaggtttctcgttaatccctgcc
gccgacgaatacgccaaacatcacaatggcgaagagctagcacgtatgggcggttggcta
atggcagccgagttgattgctcacgacatcgatttaagctttgcacccgtgctcgacaaa
ggtcatcaatgcaaagcgatcggtaaccgttcatttggtgaagatgccgataccatcctt
cgttatagcaccgcttatatgcagggtatgaagagcgtaggaatggcgacgaccggaaaa
cacttcccgggtcatggtggtgtgattgctgactcacatttagaaacgccatacgacgag
cgcagcgatatttttgaacaagacatggctatcttcaaagcgcaaattgatgccggtatt
ttagatgccatgatgcctgctcacgtgattttcccgaactacgattctcagcccgcaagt
ggttctgaatactggttgaaacacgttttacgtcaaaagcttggttttaaaggcttaatt
ttctccgatgatttgacgatggaaggcgctgcgatcatgggaagccccgctgagcgtggg
gctcaagccatgaaagccggttgcgatatgctattgatgtgtaataagcgtgaagcacaa
gttgaagtgttggataacttgcctgtttcaaccgtgccactggcggatgcgctactcaaa
aaacagtcgttttctttaagcgatctcaaattgtctcatgagtggaaagcggcgagtgaa
gcgatgaaacgcttgaccagctaa

DBGET integrated database retrieval system