KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0583Help
Entry
VP0583            CDS       T00120                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00620  Pyruvate metabolism
vpa00630  Glyoxylate and dicarboxylate metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01200  Carbon metabolism
Module
vpa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VP0583
   00630 Glyoxylate and dicarboxylate metabolism
    VP0583
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VP0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 1188058
NCBI-ProteinID: NP_796962
UniProt: Q87S41
Position
I:608715..610349
Genome map
AA seq 544 aa AA seqDB search
MIMLAQTEQKTQPSQQTQGMLEVTGALAPEHQAIFPVEAQTFLSLLCEKFAGRVEELLEA
REEKQALIDAGELPDFLPDTQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNAN
VKVFMADFEDSMSPAWDKVLDGQVNLRDAVNGNISYTNPSNGKHYQLVDDPAVLICRVRG
LHLKEKHVTWHGQIIPGALFDFALYFYNNHKALLQKGSGPYFYLPKLQSHHEAKWWSEVF
HFTEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKK
HPVRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDPQENQKVLDKI
HNDKSLEANNGHDGTWVAHPGLADTAMEVFSAALGERTNQLDVSRSEDAPITAAELLEPC
DGERTEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLD
NGQQVTKALFETYLQEEVEVVKQEVGEERYQAGRFEEAAQLMAKLTTSDELTNFLTVPGY
DYLD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcttgctcagacagaacaaaaaacacaaccatcacagcaaacccaaggcatg
cttgaggtgactggagcacttgctccggagcatcaagctattttccctgttgaagcccaa
acctttttatctctgctgtgtgaaaaatttgctgggcgtgttgaagagttgttggaagcg
agagaagaaaagcaagcactcatcgacgctggggagttgccagacttcctgcctgataca
caagatattcgtgaaggtagctggaagatcttaggtattcctcaggatctacaagatcgc
cgtgttgagattacaggcccaacggatcgcaaaatggtgatcaacgctttgaatgcaaat
gtaaaagtattcatggcggatttcgaagactctatgtcgccagcttgggacaaggttctc
gatggtcaagttaacttgcgagatgccgttaatggcaacattagctacaccaaccctagc
aatggcaagcattatcagctggtggacgacccagcggtgttgatctgccgtgttcgcggc
cttcacttaaaagaaaaacacgtgacgtggcacggtcagatcattccaggcgcgcttttt
gattttgcactgtatttctacaataaccacaaagcattgcttcaaaaaggcagcggtcca
tatttctatcttcctaaactgcagtctcatcatgaggcgaagtggtggagtgaagtgttc
catttcacagaagaatattttggtttagagactggcacgatcaaagcgaccgtgctgatc
gaaacgttaccagctgtgtttgagatggatgagattttgttctcacttaaagagcatatc
gtagggctgaattgtggtcgttgggattacattttcagttacatcaaaacactgaagaaa
cacccagttcgtgttctgccggatcgccaagtcgtcaccatggacaaaccatttttgaac
gcctattcgcgtttgttggttcgtacttgtcacaagcgtggtgctttcgcgatgggagga
atggccgcctttattcccgcgaaagacccgcaagaaaaccagaaagtgttggataaaatt
cacaacgataaatcacttgaggcgaataacggtcacgacggtacgtgggttgcccacccg
ggtctagccgatactgctatggaagtattcagtgcggcacttggagagcgaacaaatcaa
ctagatgttagtcgctccgaagatgcgccaattaccgcagccgagttgctagaaccgtgt
gacggtgaacgtacagaagaaggcatgcgccacaacattcgcgttgcgctgcaatacatc
gaagcttggatttctggaaacggctgtgtaccaatctacggattaatggaagatgctgcg
actgctgagatttctcgcgcctcaatctggcaatggattcagcacggtaagtcactcgac
aatggtcaacaggtgacaaaagcactgttcgaaacctacttgcaagaagaagtagaagta
gtgaaacaagaagtgggcgaagaacgttatcaagccgggcgttttgaagaagccgcacaa
ttgatggcgaagctaacaactagcgatgagctaaccaacttcttaaccgtccctggttat
gactacctggactaa

DBGET integrated database retrieval system