KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0583Help
Entry
VP0583            CDS       T00120                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VP0583
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VP0583
   00630 Glyoxylate and dicarboxylate metabolism
    VP0583
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VP0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:608715..610349
Genome map
AA seq 544 aa AA seqDB search
MIMLAQTEQKTQPSQQTQGMLEVTGALAPEHQAIFPVEAQTFLSLLCEKFAGRVEELLEA
REEKQALIDAGELPDFLPDTQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNAN
VKVFMADFEDSMSPAWDKVLDGQVNLRDAVNGNISYTNPSNGKHYQLVDDPAVLICRVRG
LHLKEKHVTWHGQIIPGALFDFALYFYNNHKALLQKGSGPYFYLPKLQSHHEAKWWSEVF
HFTEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKK
HPVRVLPDRQVVTMDKPFLNAYSRLLVRTCHKRGAFAMGGMAAFIPAKDPQENQKVLDKI
HNDKSLEANNGHDGTWVAHPGLADTAMEVFSAALGERTNQLDVSRSEDAPITAAELLEPC
DGERTEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLD
NGQQVTKALFETYLQEEVEVVKQEVGEERYQAGRFEEAAQLMAKLTTSDELTNFLTVPGY
DYLD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcttgctcagacagaacaaaaaacacaaccatcacagcaaacccaaggcatg
cttgaggtgactggagcacttgctccggagcatcaagctattttccctgttgaagcccaa
acctttttatctctgctgtgtgaaaaatttgctgggcgtgttgaagagttgttggaagcg
agagaagaaaagcaagcactcatcgacgctggggagttgccagacttcctgcctgataca
caagatattcgtgaaggtagctggaagatcttaggtattcctcaggatctacaagatcgc
cgtgttgagattacaggcccaacggatcgcaaaatggtgatcaacgctttgaatgcaaat
gtaaaagtattcatggcggatttcgaagactctatgtcgccagcttgggacaaggttctc
gatggtcaagttaacttgcgagatgccgttaatggcaacattagctacaccaaccctagc
aatggcaagcattatcagctggtggacgacccagcggtgttgatctgccgtgttcgcggc
cttcacttaaaagaaaaacacgtgacgtggcacggtcagatcattccaggcgcgcttttt
gattttgcactgtatttctacaataaccacaaagcattgcttcaaaaaggcagcggtcca
tatttctatcttcctaaactgcagtctcatcatgaggcgaagtggtggagtgaagtgttc
catttcacagaagaatattttggtttagagactggcacgatcaaagcgaccgtgctgatc
gaaacgttaccagctgtgtttgagatggatgagattttgttctcacttaaagagcatatc
gtagggctgaattgtggtcgttgggattacattttcagttacatcaaaacactgaagaaa
cacccagttcgtgttctgccggatcgccaagtcgtcaccatggacaaaccatttttgaac
gcctattcgcgtttgttggttcgtacttgtcacaagcgtggtgctttcgcgatgggagga
atggccgcctttattcccgcgaaagacccgcaagaaaaccagaaagtgttggataaaatt
cacaacgataaatcacttgaggcgaataacggtcacgacggtacgtgggttgcccacccg
ggtctagccgatactgctatggaagtattcagtgcggcacttggagagcgaacaaatcaa
ctagatgttagtcgctccgaagatgcgccaattaccgcagccgagttgctagaaccgtgt
gacggtgaacgtacagaagaaggcatgcgccacaacattcgcgttgcgctgcaatacatc
gaagcttggatttctggaaacggctgtgtaccaatctacggattaatggaagatgctgcg
actgctgagatttctcgcgcctcaatctggcaatggattcagcacggtaagtcactcgac
aatggtcaacaggtgacaaaagcactgttcgaaacctacttgcaagaagaagtagaagta
gtgaaacaagaagtgggcgaagaacgttatcaagccgggcgttttgaagaagccgcacaa
ttgatggcgaagctaacaactagcgatgagctaaccaacttcttaaccgtccctggttat
gactacctggactaa

DBGET integrated database retrieval system