KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0584Help
Entry
VP0584            CDS       T00120                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00630  Glyoxylate and dicarboxylate metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01200  Carbon metabolism
Module
vpa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VP0584
Enzymes [BR:vpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VP0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1188059
NCBI-ProteinID: NP_796963
UniProt: Q87S40
Position
I:610468..611778
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVKRINNSFRRADQIQWANGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGTTTLVIARTDANAA
DLLTSDCDPYDKDFIEGERTQEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEEA
RKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQELSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEKVQRPEFQAAEKGYTFVAHQQEVGTGYFDRMTNTIQGG
NSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacattgactcgccgccaacaaattgaagctctggaaaaagactgggcaacgaatcca
cgctggaaaaacgtaaagcgtacgtatactgcagaagaagtcgtagaactgcgtggctcg
atggtaccagcaaatacaatcgcacaacgtggtgctgataagctgtggtcactggtcaac
ggcagtgcgaaaaaaggttatgtaaactgtcttggtgcactgacaggtggtcaagccgta
caacaagcgaaagcgggtatcgaagcgatttacctatcaggctggcaggttgcggcagat
aataacactgcatcgactatgtacccggatcagtcgctatacccagtggactcagtacct
tcagtggttaagcgcatcaacaactctttccgtcgtgctgaccaaattcagtgggcgaat
ggcaagtctcctgaagatgaaggtggtattgattacttcctaccaatcgtagcggacgca
gaggcgggctttggtggcgtgctaaacgcatacgaactgatgaagtctatgatcgaagcc
ggtgccgctggtgttcactttgaagaccaactcgcttcggttaaaaaatgtggtcacatg
ggcggtaaagtactggttccgactcaagaagcggtacaaaaactggtagctgcgcgtctt
gctgcagacgtttctggtacaacaacgttagttattgcacgtactgatgcgaacgcggca
gacctgctaacttcagattgcgacccatacgataaagactttattgaaggtgagcgtact
caagaaggcttctaccgtgtacgtgcaggtatcgaccaagcgatttctcgtggtttggct
tatgcgccatatgcagacttgatttggtgtgaaactgcgacgccgtgtctagaagaggcg
cgtaagttcgcagaagcgattcacgctgagtatccagatcagctgctggcatacaactgt
tcgccatcgttcaactgggagaaaaatctcgatgcagaaaccattgcgaagttccagcaa
gagctttcagacatgggctacaagtaccagttcatcacgctagcgggtatccacaacatg
tggtttaacatgtttgaattggcacacgcttatgcgcaaggtgaaggtatgcgtcattac
gttgagaaagttcaacgtcctgaattccaagcagcagagaaaggctacaccttcgtggct
caccaacaagaagtgggtacaggttacttcgatagaatgacgaacaccatccaaggtggt
aactcatctgtcactgcgcttaccggttcgaccgaagaagaccaattctaa

DBGET integrated database retrieval system