KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0584Help
Entry
VP0584            CDS       T00120                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vpa01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:610468..611778
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVKRINNSFRRADQIQWANGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGTTTLVIARTDANAA
DLLTSDCDPYDKDFIEGERTQEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEEA
RKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQELSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEKVQRPEFQAAEKGYTFVAHQQEVGTGYFDRMTNTIQGG
NSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacattgactcgccgccaacaaattgaagctctggaaaaagactgggcaacgaatcca
cgctggaaaaacgtaaagcgtacgtatactgcagaagaagtcgtagaactgcgtggctcg
atggtaccagcaaatacaatcgcacaacgtggtgctgataagctgtggtcactggtcaac
ggcagtgcgaaaaaaggttatgtaaactgtcttggtgcactgacaggtggtcaagccgta
caacaagcgaaagcgggtatcgaagcgatttacctatcaggctggcaggttgcggcagat
aataacactgcatcgactatgtacccggatcagtcgctatacccagtggactcagtacct
tcagtggttaagcgcatcaacaactctttccgtcgtgctgaccaaattcagtgggcgaat
ggcaagtctcctgaagatgaaggtggtattgattacttcctaccaatcgtagcggacgca
gaggcgggctttggtggcgtgctaaacgcatacgaactgatgaagtctatgatcgaagcc
ggtgccgctggtgttcactttgaagaccaactcgcttcggttaaaaaatgtggtcacatg
ggcggtaaagtactggttccgactcaagaagcggtacaaaaactggtagctgcgcgtctt
gctgcagacgtttctggtacaacaacgttagttattgcacgtactgatgcgaacgcggca
gacctgctaacttcagattgcgacccatacgataaagactttattgaaggtgagcgtact
caagaaggcttctaccgtgtacgtgcaggtatcgaccaagcgatttctcgtggtttggct
tatgcgccatatgcagacttgatttggtgtgaaactgcgacgccgtgtctagaagaggcg
cgtaagttcgcagaagcgattcacgctgagtatccagatcagctgctggcatacaactgt
tcgccatcgttcaactgggagaaaaatctcgatgcagaaaccattgcgaagttccagcaa
gagctttcagacatgggctacaagtaccagttcatcacgctagcgggtatccacaacatg
tggtttaacatgtttgaattggcacacgcttatgcgcaaggtgaaggtatgcgtcattac
gttgagaaagttcaacgtcctgaattccaagcagcagagaaaggctacaccttcgtggct
caccaacaagaagtgggtacaggttacttcgatagaatgacgaacaccatccaaggtggt
aactcatctgtcactgcgcttaccggttcgaccgaagaagaccaattctaa

DBGET integrated database retrieval system