KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0593Help
Entry
VP0593            CDS       T00120                                 

Definition
(RefSeq) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00521  Streptomycin biosynthesis
vpa00562  Inositol phosphate metabolism
vpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    VP0593
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VP0593
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     VP0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 1188068
NCBI-ProteinID: NP_796972
UniProt: Q87S31
Position
I:complement(619979..620782)
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAIRAARKAGNHIAKSLENTDKVESTLKGTNDFVTNVDKEAEYIIIDTIKQSYP
EHCIVAEEQGLIEGKDKDVQWIIDPLDGTTNFVKGYPHFAVSIAVRIKGKTEVACVYDPM
QNELFTAQRGAGAQLNSARIRVTPLKDLQGTVLATGFPFKQKQHSESYIKIVGSLFTECA
DFRRSGSAALDLCYVAAGRVDGYFELGLKPWDMAAGELIAREAGAILTDFAGGTEYMKSG
NIVASSARGVKSMLKHIRENGNSAILK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaatgctaaacattgctattcgcgctgcgcgaaaagcaggcaatcatattgct
aaatcattagaaaacactgataaagtagaatctacacttaaaggcactaatgactttgtc
actaacgtagacaaagaagcagaatacatcatcatcgatactatcaagcagtcttaccca
gagcactgcatcgttgctgaagaacaaggtcttatcgaaggtaaagataaagacgtacaa
tggatcatcgacccactggatggcactactaactttgtaaaaggttacccacacttcgcg
gtttctatcgctgttcgtatcaaaggcaaaactgaagttgcttgtgtttacgatccaatg
caaaacgaactatttactgcacaacgcggtgctggtgctcagctaaacagtgcacgtatt
cgtgttactccgctgaaagaccttcaaggtactgttctagcaacaggtttcccattcaag
cagaagcaacactcagagtcttacattaagatcgttggttctctattcactgaatgtgct
gacttccgtcgtagcggctctgctgctcttgacctatgttacgtggctgctggccgtgtt
gatggttacttcgagctaggtctaaaaccttgggatatggctgcaggtgagcttattgct
cgtgaagctggcgccatcctaactgactttgctggcggcactgagtacatgaagtctggt
aacattgttgcttcaagcgctcgtggcgtgaaatctatgcttaagcatattcgcgaaaat
ggtaacagcgcgatcctcaagtaa

DBGET integrated database retrieval system