KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0676Help
Entry
VP0676            CDS       T00120                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VP0676
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VP0676
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VP0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:709222..710361
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLDDR
ERFLNARDTINALVANDIIPIVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSTEPQGTRFLPCSEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNSHGKLVARGISAYSSEDLAKITGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaaacgcagttgtttcgcaaccacaaaccgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcacattggcactagatcgcgctcacatggttgagcta
gcgcgtcagtgtgctgagcttaagaaacaaggccattcagtggtaatggtttcgtctggt
gcaattgcagcaggccgtgagcatcttggataccccgcactgcccaacgagatggcgagc
aaacagttgcttgctgctgtgggtcagagtcgtttgattcaaacatgggagtctttgttt
ggtatttacggtatcaagattggtcaaatgctactgactcgtgctgacttggatgatcgt
gagcgttttcttaatgcgcgtgacaccatcaatgcgcttgtggcgaacgatattattcca
atcgtgaacgaaaatgatgcagtagccaccagtgaaatcaaagtcggcgacaatgacaac
ctatcggctttagtgggtattttgtgtggtgcagataagttattgctactgaccgatcaa
aaaggtctgtttactgcagacccacgaaaagatccgaatgcagagctgatcaaagaagtt
aaaaccattgatgacacgttgcgtaaaattgctggcggcagcggtacaacactcggtacg
ggtggtatggcgacaaaacttcaagctgctgacatcgcacgtcgcgcgggtattgaagtt
attatcgcagcaggtagcgcgccaaacgtaatttttgactcgttgagcacggagcctcaa
ggtacgcgtttcctaccttgttcagaagcattggaaaaccgtaagcgttggatcctcgca
ggtcctgcagcatcgggtgacattatcatcgatgatggtgcggtgaatgcggttgttggt
aaaggcagcagcttgctagcaaaaggggtcatcaaggtgagcggtgattttgcccgtggt
gaagttgctcgcgtaacaaattctcatggcaaactggttgcgcgtggtattagcgcctac
tcaagtgaagacttggcaaaaattactggcaaacacagtaaagacatcatctctattttg
ggtcatgactacggctcagaagtgattcatcgcgatgatcttgtcgtcattcaagaatag

DBGET integrated database retrieval system