KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0740Help
Entry
VP0740            CDS       T00120                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00900  Terpenoid backbone biosynthesis
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01130  Biosynthesis of antibiotics
Module
vpa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VP0740 (ipk)
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     VP0740 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Hce2
Motif
Other DBs
NCBI-GeneID: 1188235
NCBI-ProteinID: NP_797119
UniProt: Q87RN7
Position
I:complement(777619..778506)
Genome map
AA seq 295 aa AA seqDB search
MEHHPMIETSTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIQANHSGDVT
ISPEIEGVPLQDNLIWKAATALQNYAHCSFGAHIELHKVLPMGGGIGGGSSNAATTLVAL
NYLWQLNLTDDELAEIGLKLGADVPVFVRGFSAFAEGVGEKLSPANPEEKWYLVVRPNVS
IATADIFRHPDLTRNTPKRDLETLLNAPSVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLT
GTGSCVFAEFSSKSEAETILAQLSDKVSAFVAQGRNISPLKETLAEYQSASHRPI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcacccaatgatcgaaacttcaacccgctggccgtctccggcgaaattgaat
ctctttctatacatcaatggccgcacagaaaacggctatcacgagttacaaaccttattc
caattcgtcgatcacggagatgagctcaccattcaagcaaaccattctggtgatgttacg
atttctccagagatagaaggtgtgcctcttcaagacaatttaatttggaaagctgcaact
gcgctgcaaaattacgctcactgctcttttggtgcacatatcgaactgcacaaagtttta
ccaatgggtggtggaattggcggcggctcttcaaatgccgctacgacacttgtggcactc
aactacttgtggcagctcaatttaactgatgatgaattagccgaaattggcctaaaactg
ggcgctgacgtgcctgtttttgtgcgcggtttttccgcttttgctgaaggtgtgggtgag
aagctttctccagccaacccggaagaaaagtggtatctcgtcgtgagaccaaatgtttct
attgcgacagcggatatattccgtcatccagatctgacacgaaacacaccaaaacgagat
ctagaaacacttttgaacgcgccgagcgtaaacgattgcgaaaaaattgtacgaatgctc
tacccagaggttgataagcaactttcatggctgctacaatacgcgccgtcaagattgacg
gggacaggatcttgcgtttttgctgaattttcgagcaaatcggaagcagaaactatcctt
gcacaactctctgataaagtctcggcatttgtcgctcaagggcgcaatatttcgccacta
aaagagactttggctgaataccaatcagcctcacaccgacctatttaa

DBGET integrated database retrieval system