KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0740Help
Entry
VP0740            CDS       T00120                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vpa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(777619..778506)
Genome map
AA seq 295 aa AA seqDB search
MEHHPMIETSTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIQANHSGDVT
ISPEIEGVPLQDNLIWKAATALQNYAHCSFGAHIELHKVLPMGGGIGGGSSNAATTLVAL
NYLWQLNLTDDELAEIGLKLGADVPVFVRGFSAFAEGVGEKLSPANPEEKWYLVVRPNVS
IATADIFRHPDLTRNTPKRDLETLLNAPSVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLT
GTGSCVFAEFSSKSEAETILAQLSDKVSAFVAQGRNISPLKETLAEYQSASHRPI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcacccaatgatcgaaacttcaacccgctggccgtctccggcgaaattgaat
ctctttctatacatcaatggccgcacagaaaacggctatcacgagttacaaaccttattc
caattcgtcgatcacggagatgagctcaccattcaagcaaaccattctggtgatgttacg
atttctccagagatagaaggtgtgcctcttcaagacaatttaatttggaaagctgcaact
gcgctgcaaaattacgctcactgctcttttggtgcacatatcgaactgcacaaagtttta
ccaatgggtggtggaattggcggcggctcttcaaatgccgctacgacacttgtggcactc
aactacttgtggcagctcaatttaactgatgatgaattagccgaaattggcctaaaactg
ggcgctgacgtgcctgtttttgtgcgcggtttttccgcttttgctgaaggtgtgggtgag
aagctttctccagccaacccggaagaaaagtggtatctcgtcgtgagaccaaatgtttct
attgcgacagcggatatattccgtcatccagatctgacacgaaacacaccaaaacgagat
ctagaaacacttttgaacgcgccgagcgtaaacgattgcgaaaaaattgtacgaatgctc
tacccagaggttgataagcaactttcatggctgctacaatacgcgccgtcaagattgacg
gggacaggatcttgcgtttttgctgaattttcgagcaaatcggaagcagaaactatcctt
gcacaactctctgataaagtctcggcatttgtcgctcaagggcgcaatatttcgccacta
aaagagactttggctgaataccaatcagcctcacaccgacctatttaa

DBGET integrated database retrieval system