KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0844Help
Entry
VP0844            CDS       T00120                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VP0844
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VP0844
   00650 Butanoate metabolism
    VP0844
  Energy metabolism
   00190 Oxidative phosphorylation
    VP0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:874566..874910
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFSDISYASWTQFFGGTFTKVFT
MLALASVLIHAWIGMWQVFTDYIKCAKLRGALQLGVIAVLFGYVFSGLFILWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtatcttcatttggtcgtaatggtgtacacgatttcctactgattcgt
gcaacagccatcattatgacgctatacacgatttatctggttagcttctgtgcattttca
gatatctcttacgcatcatggacccaattctttggtggtactttcaccaaagtcttcacc
atgttggcgcttgcatctgttctgattcatgcatggatcggtatgtggcaagtgttcacc
gactacattaagtgcgcgaaacttcgtggtgcacttcaacttggtgtgattgccgtttta
ttcggttatgtcttctctggtctatttattctgtggggtgcgtaa

DBGET integrated database retrieval system