KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0844Help
Entry
VP0844            CDS       T00120                                 

Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00020  Citrate cycle (TCA cycle)
vpa00190  Oxidative phosphorylation
vpa00650  Butanoate metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
vpa01200  Carbon metabolism
Module
vpa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VP0844
   00650 Butanoate metabolism
    VP0844
  Energy metabolism
   00190 Oxidative phosphorylation
    VP0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-GeneID: 1188341
NCBI-ProteinID: NP_797223
UniProt: Q87RF3
Position
I:874566..874910
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFSDISYASWTQFFGGTFTKVFT
MLALASVLIHAWIGMWQVFTDYIKCAKLRGALQLGVIAVLFGYVFSGLFILWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtatcttcatttggtcgtaatggtgtacacgatttcctactgattcgt
gcaacagccatcattatgacgctatacacgatttatctggttagcttctgtgcattttca
gatatctcttacgcatcatggacccaattctttggtggtactttcaccaaagtcttcacc
atgttggcgcttgcatctgttctgattcatgcatggatcggtatgtggcaagtgttcacc
gactacattaagtgcgcgaaacttcgtggtgcacttcaacttggtgtgattgccgtttta
ttcggttatgtcttctctggtctatttattctgtggggtgcgtaa

DBGET integrated database retrieval system