KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0848Help
Entry
VP0848            CDS       T00120                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VP0848
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VP0848
  Amino acid metabolism
   00310 Lysine degradation
    VP0848
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VP0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:880426..881631
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKQPGDTVERDEVLVDIETDKVVLEVPAPEAGVLEAIL
EVEGATVLSKQLLAKLKAGAVAGEPTADKTEATEASPDKRHKATLTEESNDALSPAVRRL
LAEHGLEAHQVKGTGVGGRITREDIEAHLANAKAAPKADAPAVEAPATARSEKRVPMTRL
RKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQFEERHGIRLGFMSFYVKAVTE
ALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDKLGFADVEKGIKELAI
KGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQERPMAVNGKVEI
LPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatttacctgaatcagttgctgatgcaaccgtggcg
acatggcacaaacaaccaggcgacaccgtagagcgtgatgaagttctggttgatattgaa
actgacaaagttgtactagaagtgccagctccagaagccggcgttttagaagccattctt
gaagtagaaggtgctacggtactttcaaagcaacttcttgctaaattgaaagccggcgct
gttgcgggcgagccaaccgcagacaaaacagaagcaacagaagcttctccagataagcgt
cacaaagcgacactgactgaagaaagcaatgatgcacttagccctgccgttcgtcgtcta
cttgcggaacatggtctagaagcacaccaagttaaaggtactggtgttggcggtcgtatt
actcgtgaagatatcgaagcgcatctagcaaacgctaaagcggctccaaaagctgatgct
ccagcagttgaagcaccagcaaccgctcgtagtgagaagcgtgtgccaatgactcgccta
cgtaagacggttgcaaaccgcctgctggaagcgaaaaacagcaccgcaatgctaacgacg
tttaacgaagtgaacatgaagccaatcatggatcttcgtaagcaatacaaagaccagttc
gaagagcgtcacggtattcgtcttggcttcatgtctttctatgtgaaagcagtgacagaa
gcactaaaacgttacccagaagtaaatgcatcaatcgatggtgatgatatcgtttaccac
aattactttgacattagcatggcggtatcaacgccacgtggtctagtaactccagtgcta
aaagactgtgacaagcttggttttgcagatgttgaaaaaggcatcaaagagctagcgatc
aaaggtcgtgatggcaagttaacagtagatgagttgatggggggtaacttcactatcact
aacggtggtgtgttcggttctctaatgtctacgcctatcatcaacccaccgcaatcggca
atccttggtatgcataaaatccaagaacgcccgatggctgtaaacggtaaagttgaaatc
ctaccgatgatgtacctggcgctatcttacgaccaccgtttgatcgatggccgtgagtca
gttggcttcctagtaacgattaaagagctactagaagatccagcgcgtctcctattagac
gtttaa

DBGET integrated database retrieval system