KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1051Help
Entry
VP1051            CDS       T00120                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VP1051 (ruvA)
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VP1051 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1101517..1102131
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGILLEKQPPEVLIEVNGIGYEVQMPMSCFYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVSCVEREDVSTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPFTDAAPTDSAAASSNSAEEEAVSALLALGYKPTQASK
VVSQIAKPDMSSEQLIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggcattttgcttgaaaagcaaccacctgaagttttaattgaa
gttaacggcattggctatgaagttcagatgccaatgagctgtttctacgaactgccaaat
atcggcgaagaagcgattatttatactcattttgttgtgcgtgaagacgcgcaattgctt
tacggttttaatacagtaaaagagcgtgcgctattccgtgaagtgatcaaagcaaacggc
gttggccctaaacttggcttaggtattctttcaggcatgacagcgagccagttcgtgtct
tgtgtagagcgtgaagatgtttctacgcttgtgaagttaccaggtgttggtaagaaaacc
gccgagcgtttggtcgttgaaatgaaagaccgcttaaaaggttggggagctggcgactta
ttcacgccgtttactgatgccgctcctactgactcggctgccgcttcgtcaaatagtgca
gaagaagaggcggtcagcgcacttcttgctctaggctacaagccaactcaagcgtcgaaa
gtagtttctcaaattgctaaaccggacatgagcagcgagcagctgatccgtgaagcacta
aaatcaatggtgtaa

DBGET integrated database retrieval system