KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1051Help
Entry
VP1051            CDS       T00120                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1101517..1102131
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGILLEKQPPEVLIEVNGIGYEVQMPMSCFYELPNIGEEAIIYTHFVVREDAQLL
YGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVSCVEREDVSTLVKLPGVGKKT
AERLVVEMKDRLKGWGAGDLFTPFTDAAPTDSAAASSNSAEEEAVSALLALGYKPTQASK
VVSQIAKPDMSSEQLIREALKSMV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtcttcgcggcattttgcttgaaaagcaaccacctgaagttttaattgaa
gttaacggcattggctatgaagttcagatgccaatgagctgtttctacgaactgccaaat
atcggcgaagaagcgattatttatactcattttgttgtgcgtgaagacgcgcaattgctt
tacggttttaatacagtaaaagagcgtgcgctattccgtgaagtgatcaaagcaaacggc
gttggccctaaacttggcttaggtattctttcaggcatgacagcgagccagttcgtgtct
tgtgtagagcgtgaagatgtttctacgcttgtgaagttaccaggtgttggtaagaaaacc
gccgagcgtttggtcgttgaaatgaaagaccgcttaaaaggttggggagctggcgactta
ttcacgccgtttactgatgccgctcctactgactcggctgccgcttcgtcaaatagtgca
gaagaagaggcggtcagcgcacttcttgctctaggctacaagccaactcaagcgtcgaaa
gtagtttctcaaattgctaaaccggacatgagcagcgagcagctgatccgtgaagcacta
aaatcaatggtgtaa

DBGET integrated database retrieval system