KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1163Help
Entry
VP1163            CDS       T00120                                 

Definition
alpha-1,6-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VP1163
  Lipid metabolism
   00561 Glycerolipid metabolism
    VP1163
   00600 Sphingolipid metabolism
    VP1163
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VP1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1219738..1221477
Genome map
AA seq 579 aa AA seqDB search
MAQTIQLANHSEMTIIDNDLHVDVIGNQAHFSFSGLHNKTFTDREVLFEMPFLYEHEANV
IGDGFQMLAQTSGTITHPIEIGRCPDNIPPYRVYSQHAPKRYYNYLVIEDSAGYTLFGFT
TCRRFAGYFDIQQRNGQWILTAAIDGEHTQVADWEHNQLESITILTGNSLSDLYQEFSEM
IAVHHPIRNGVTQDAPIGWCSWYAYYADVTEQNVLENVDCMQDKLEDLEWVLLDDGYQAF
MGDWLTPSDKFSGGVKELIQNIRAKGKKPAIWMAPFIAQPESEVFKQHPEWFVRHPDGQL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTHVVSVMRLEWGVELFKLDANYWGTLKGKR
SQSGITGVEAYRLGMEAIARGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSHRFEQI
AKETFFRSWQHRKLWQIDPDCATFTSLANQAASREDYEFHRTVLLASGGLLLSGDPLPEI
TPFASKTLAKLMLRQRRSQESAKFTALSLSHAFLKLTDKNDLHCLFNYANHNATEFTLTA
DQPVDWYDYWTGEKLNQDPCQLLLVSVDRGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccattcagttagccaaccattccgaaatgacgatcatcgataacgatctg
cacgtggatgtgattggtaatcaagcccatttctctttctctgggcttcacaataagacc
tttactgaccgtgaagtgttgttcgaaatgccgtttctatacgagcacgaagccaacgtg
attggtgatggttttcaaatgttggcgcaaacgtcaggaacgatcacgcatcctattgaa
ataggtcgctgccccgacaacattcccccataccgtgtgtactcgcaacatgcacctaag
cgttactacaactatctagtgattgaggattctgctggttacaccttgtttggcttcacg
acgtgccgtcgatttgctggttactttgatatacaacagcgaaatgggcagtggatactg
accgcagcaattgatggtgaacacacgcaagtggcggattgggaacacaatcaacttgag
tccattacgattttaactggcaactcgctatccgatctgtatcaagagttcagcgagatg
attgccgtgcatcatcctattcgcaacggtgttacgcaggatgcaccgataggctggtgt
tcttggtatgcgtactatgccgatgtgaccgagcaaaatgttttagaaaatgttgattgc
atgcaagacaagctcgaagacctagaatgggtacttctggatgatggctatcaagcgttc
atgggggattggcttacgccgtcggataaattctctggcggtgtgaaggagttgattcaa
aacattcgcgcaaaaggcaaaaagcctgcgatttggatggctcctttcatagcgcagcca
gaatctgaggtctttaagcaacatcctgaatggtttgttcgtcatcctgacggtcagctc
cttaaagctgaagatgttacctacggtggctggcgttgcacgccttggtatattctcgat
acgtctaaccccgaagtgcaagatcatctaacgcacgtggtgtcagtgatgaggctagag
tggggcgtagagctgtttaagctcgatgcaaactactggggaacactaaaaggaaaacgt
agtcagtctggtattacgggtgttgaagcgtatcgattagggatggaggcgatcgccaga
ggcgcaggagacgcgtggttgcttggctgcaacgcgccaatgtggccatctttggggctg
gtggatgcgatgcgtgtgtctgatgacgtcgagcgccatagccaccgttttgaacagatc
gctaaagagacgtttttccgtagctggcagcaccgtaaattgtggcaaattgacccagac
tgcgcgacgtttacttctcttgctaatcaagctgcatcacgtgaagactacgagtttcac
cgtaccgtattattggcgtctggcggcttgcttttgtctggcgaccctctcccggaaatc
acgccatttgcgagtaaaacgttggcgaagctgatgttgcgacaacgacgcagccaagaa
tctgctaagttcacggcgttaagtttgagccatgcttttttgaaactgacggacaagaat
gatctacattgtttgttcaattacgcgaatcacaatgcgactgaatttactctcacagcg
gatcagcccgttgattggtatgactactggaccggagaaaagctcaaccaagatccttgt
cagttgcttctagtgagtgtcgatagaggtctgaatgccaaagcaatagtgaccgcgtaa

DBGET integrated database retrieval system