KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1260Help
Entry
VP1260            CDS       T00120                                 

Definition
outer membrane phospholipase subunit A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VP1260
   00565 Ether lipid metabolism
    VP1260
   00590 Arachidonic acid metabolism
    VP1260
   00591 Linoleic acid metabolism
    VP1260
   00592 alpha-Linolenic acid metabolism
    VP1260
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VP1260
    3.1.1.32  phospholipase A1
     VP1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1334027..1334836
Genome map
AA seq 269 aa AA seqDB search
MIRNDIAALWFGGKRITMKYKVIPLLLCPVLAYGKDITHISTYEDNYVLGTYTTDINQSA
YSEMGSEMDSLQDFEVKFQISASIPFYRFSSGTALMGAYTQKSLWQLANSDISSPFRETN
YKPQVFLAHQSNMLLFNHVEAGYKHESNGQSSKLSRSWDRLYVAAERFSGPVEYGVHAWW
VITTENDDMENYYAPYELWAKVYTRAGVVNTRGFYNFADDKGGVELGYTFYFNDILGVYL
QGYHGYGETLIDYDHSQTRVGLGIKLMNL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgataaggaatgatattgccgctttatggtttggcggcaaaaggataacgatgaagtat
aaagtaattccgctcttgttgtgccccgtacttgcttacggaaaagacattacccatatc
tcaacctacgaagacaactacgttctaggtacatacaccacagacatcaaccaaagcgcc
tatagcgaaatgggctcagagatggattcactgcaagattttgaagtgaagtttcagatc
tcagcatcaattccattttatcgcttcagctcaggcactgctttgatgggggcttatact
caaaagtccctatggcaactggcaaactctgatatctcctcgccatttagagaaacaaac
tacaagccgcaagtgttcttagcacatcaatcgaacatgttgttgttcaatcatgttgaa
gccggttacaaacatgaatcgaacggtcaatccagcaaactgtcacgcagttgggaccgt
ctatatgtcgctgccgagcgtttttctggcccagtcgagtatggcgtacatgcatggtgg
gtgattaccacagaaaatgacgacatggaaaattactacgcaccttacgagttgtgggcg
aaagtttatacccgtgcgggcgtggtcaatacacgcggtttttacaactttgctgatgat
aaaggtggggttgaactaggttacacattctatttcaatgacattcttggtgtatatctt
caaggttaccatggctacggtgaaacgctgatcgactatgaccattctcaaacccgtgtt
gggcttggtattaagctgatgaatctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system