KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1262Help
Entry
VP1262            CDS       T00120                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00790  Folate biosynthesis
vpa01100  Metabolic pathways
vpa02020  Two-component system
Module
vpa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VP1262
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VP1262
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VP1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos TAT_signal DUF993
Motif
Other DBs
NCBI-GeneID: 1188767
NCBI-ProteinID: NP_797641
UniProt: Q87Q88
Position
I:1335830..1337503
Genome map
AA seq 557 aa AA seqDB search
MSLSRRDFMKVVSSTAVATGLIGCGSDDNESVAVSFEHGVASGDPTQAQVIIWTRVTTAA
SYVDVTWQVASDVEFSNVVQSGVFTTDTGRDFTVKVDVQNLNANSQYYYRFMVGEMMSEV
GQTQTLPEDGVEKASMAVVSCANYPAGYFHVYREILNQHEQSPFDVVLHLGDYIYEYGAG
GYASEDAAALGREPSKGTECITLDDYRKRYAQYRQEADLQALHAKLPMIAVWDDHELAND
TWKNGAENHQDDEGSFIDRRAAAAAAWTEWLPVRENTFSNMLIYRQFSFGNLVNLMMLDT
RLVGRDKPLDYFSLSAPTMEAIGGLVAQSRSADRELLGTEQLAWLMNEFNTHDAKWNVLG
QQVLMSRMELPSSVMTAMFQLFTSTEEKKTEALLAVNTAITGYLADPSADPISLPYNLDA
WDGYYVEREKVYQLAKASSGNFVCLAGDTHNAWASELKDVSNNPIGVEFATSSVSSPGLE
EYLALDPVAIAQMEYTLPHLVSELKWADIKQRGFMRVTFTADAAQSTWYLVSTIKDKKYQ
VTTKSASTTNGTTLDII
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtctcgtcgagactttatgaaagttgtctcttcaaccgccgttgctaccggt
ctaatcggttgtggcagcgacgataatgaatccgttgccgttagttttgaacatggtgtc
gccagtggcgatccgactcaagcacaagtgattatttggactcgggtgactacagccgcg
agttacgtggatgtgacctggcaagtcgcatccgacgtggagttttccaatgtcgtgcaa
agtggcgtattcactaccgatacaggacgtgatttcacggtaaaagtggacgtacaaaac
ctcaacgccaattctcagtactactaccgatttatggtcggcgagatgatgagtgaggta
gggcaaactcaaactctgcctgaagatggtgtcgaaaaagcatcgatggcggtggtgtct
tgcgccaactatccagcgggttatttccacgtttatcgcgagatcttaaatcaacatgaa
caatcgccattcgacgttgtgttacatcttggtgactacatttatgaatatggggctgga
ggctatgccagtgaagatgccgctgcattagggcgcgaaccgagcaaaggcacagaatgt
atcacgctggacgattaccgaaaaagatacgcccaatatcgtcaagaggcagatctgcaa
gcattacatgccaaactgcccatgattgcagtttgggatgatcacgagttagctaatgac
acatggaaaaatggcgcagagaaccatcaagacgacgaaggtagctttatcgaccgtcga
gccgccgctgcggctgcatggactgagtggttgccagttcgtgagaatacattctcaaac
atgttgatttatcgtcagttctcatttggcaacttagtgaatctcatgatgctcgatacg
cgccttgttggtcgtgataaaccgttggattacttctcactcagtgcaccaacaatggaa
gccatcggtgggttagttgctcaatcacgcagtgcagacagagagctgctaggcactgaa
caacttgcttggttgatgaatgaattcaacacgcacgatgcaaaatggaacgttctaggc
caacaagttttgatgtcgcgaatggagctaccaagttcagtgatgacggcgatgttccaa
ctgtttacgtcaacagaagagaagaaaacagaagcgttgttggcggtgaatacagcgatc
acgggttatcttgccgatccaagtgcagatcccatttctctgccttacaacctcgatgct
tgggatggttactatgtcgagcgtgaaaaagtctaccaactggccaaagcaagtagtggc
aattttgtgtgtttagcgggcgatactcacaacgcgtgggcaagtgagttaaaagatgtg
tcaaataatccgataggggtcgagtttgcgacgagctcggtgagctctccggggttagaa
gagtatttggcgttggacccggtggcgattgctcaaatggaatacaccttgccgcattta
gtctccgagctgaaatgggctgacatcaaacaacgtggctttatgcgagtgacctttact
gctgatgccgctcaatcgacgtggtacttggtgtcgaccatcaaagataaaaagtatcag
gtgacgacgaagtcggcgtctacgacaaatggcacaacgttagacattatctaa

DBGET integrated database retrieval system