KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1262Help
Entry
VP1262            CDS       T00120                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpa00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vpa00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vpa02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1335830..1337503
Genome map
AA seq 557 aa AA seqDB search
MSLSRRDFMKVVSSTAVATGLIGCGSDDNESVAVSFEHGVASGDPTQAQVIIWTRVTTAA
SYVDVTWQVASDVEFSNVVQSGVFTTDTGRDFTVKVDVQNLNANSQYYYRFMVGEMMSEV
GQTQTLPEDGVEKASMAVVSCANYPAGYFHVYREILNQHEQSPFDVVLHLGDYIYEYGAG
GYASEDAAALGREPSKGTECITLDDYRKRYAQYRQEADLQALHAKLPMIAVWDDHELAND
TWKNGAENHQDDEGSFIDRRAAAAAAWTEWLPVRENTFSNMLIYRQFSFGNLVNLMMLDT
RLVGRDKPLDYFSLSAPTMEAIGGLVAQSRSADRELLGTEQLAWLMNEFNTHDAKWNVLG
QQVLMSRMELPSSVMTAMFQLFTSTEEKKTEALLAVNTAITGYLADPSADPISLPYNLDA
WDGYYVEREKVYQLAKASSGNFVCLAGDTHNAWASELKDVSNNPIGVEFATSSVSSPGLE
EYLALDPVAIAQMEYTLPHLVSELKWADIKQRGFMRVTFTADAAQSTWYLVSTIKDKKYQ
VTTKSASTTNGTTLDII
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtctcgtcgagactttatgaaagttgtctcttcaaccgccgttgctaccggt
ctaatcggttgtggcagcgacgataatgaatccgttgccgttagttttgaacatggtgtc
gccagtggcgatccgactcaagcacaagtgattatttggactcgggtgactacagccgcg
agttacgtggatgtgacctggcaagtcgcatccgacgtggagttttccaatgtcgtgcaa
agtggcgtattcactaccgatacaggacgtgatttcacggtaaaagtggacgtacaaaac
ctcaacgccaattctcagtactactaccgatttatggtcggcgagatgatgagtgaggta
gggcaaactcaaactctgcctgaagatggtgtcgaaaaagcatcgatggcggtggtgtct
tgcgccaactatccagcgggttatttccacgtttatcgcgagatcttaaatcaacatgaa
caatcgccattcgacgttgtgttacatcttggtgactacatttatgaatatggggctgga
ggctatgccagtgaagatgccgctgcattagggcgcgaaccgagcaaaggcacagaatgt
atcacgctggacgattaccgaaaaagatacgcccaatatcgtcaagaggcagatctgcaa
gcattacatgccaaactgcccatgattgcagtttgggatgatcacgagttagctaatgac
acatggaaaaatggcgcagagaaccatcaagacgacgaaggtagctttatcgaccgtcga
gccgccgctgcggctgcatggactgagtggttgccagttcgtgagaatacattctcaaac
atgttgatttatcgtcagttctcatttggcaacttagtgaatctcatgatgctcgatacg
cgccttgttggtcgtgataaaccgttggattacttctcactcagtgcaccaacaatggaa
gccatcggtgggttagttgctcaatcacgcagtgcagacagagagctgctaggcactgaa
caacttgcttggttgatgaatgaattcaacacgcacgatgcaaaatggaacgttctaggc
caacaagttttgatgtcgcgaatggagctaccaagttcagtgatgacggcgatgttccaa
ctgtttacgtcaacagaagagaagaaaacagaagcgttgttggcggtgaatacagcgatc
acgggttatcttgccgatccaagtgcagatcccatttctctgccttacaacctcgatgct
tgggatggttactatgtcgagcgtgaaaaagtctaccaactggccaaagcaagtagtggc
aattttgtgtgtttagcgggcgatactcacaacgcgtgggcaagtgagttaaaagatgtg
tcaaataatccgataggggtcgagtttgcgacgagctcggtgagctctccggggttagaa
gagtatttggcgttggacccggtggcgattgctcaaatggaatacaccttgccgcattta
gtctccgagctgaaatgggctgacatcaaacaacgtggctttatgcgagtgacctttact
gctgatgccgctcaatcgacgtggtacttggtgtcgaccatcaaagataaaaagtatcag
gtgacgacgaagtcggcgtctacgacaaatggcacaacgttagacattatctaa

DBGET integrated database retrieval system