KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1718Help
Entry
VP1718            CDS       T00120                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VP1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1831250..1832284
Genome map
AA seq 344 aa AA seqDB search
MRRSSESRKSRQKEVIMKTLIAVSVLSILSFGAHAERQSNEPIKVIEPISGLDSKKIELG
KTLWFEPRLSASNTISCNSCHNIAKGGVDNLPSSIGHKWSIGPINSPTVFNSDLNFVQFW
NGRAKDLQEQAAGPIENPLEMAFTHQLAVDTLQSIPQYRKWFQQAYGSDNITIDNVTDAI
ATFEQTLRTPNSPFDLWLKGNDDALTTAQVEGYQLFKDKGCTACHSGPLAGGQMYQKMGL
VKPFTTDNPDVGRKAITGSDFDKFVFKVPTLRNVELTYPYFHDGSVWDLQEAVEMMADLQ
LGQKLTKEESTKITEFLRSLTGEQPQVTLPHLPPSTHETARPNI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgctctagtgagagtcgaaaatcacgtcaaaaggaagttattatgaaaactctt
atcgcagtgagtgttttatctatattgtctttcggtgcccatgctgaacgtcaatccaac
gaacccatcaaggtcatcgaacccatttctgggctcgacagtaaaaagattgaattgggt
aaaacgctgtggtttgaaccgagactgtcggcgtcgaacaccatttcttgcaactcttgc
cataacatcgctaaaggtggcgttgataacttaccaagctcaattggtcacaaatggtca
attggcccaatcaactcacctacggtgtttaattcagatttgaatttcgttcaattttgg
aatgggcgagcgaaagatctgcaagagcaagccgcaggccctatcgaaaacccattggaa
atggcatttacccaccaactcgcggtcgacactcttcaatctatccctcaataccgcaag
tggtttcaacaagcttatggcagcgacaatatcaccattgataacgtgaccgatgctatc
gcaacatttgaacaaacgctgcgtacgccaaactctccattcgatttatggttgaaaggt
aacgacgacgcacttactactgcacaggtggaaggctatcaactgtttaaagacaaaggc
tgtactgcttgtcacagcgggccattagcaggcggacagatgtatcaaaaaatggggtta
gtgaagccatttacgacagacaacccagatgttggccgcaaagccattaccggaagtgat
ttcgataagttcgtcttcaaagtcccaaccttacgtaacgtagaattgacctacccgtac
ttccatgacgggtctgtttgggatcttcaagaagcggtagaaatgatggccgatctgcaa
cttggtcaaaagctaacgaaagaagagtccaccaaaatcactgaattcttacgctctctg
acaggtgaacaaccacaagtcaccttgcctcacttaccaccatcaactcatgaaaccgca
aggccaaatatttaa

DBGET integrated database retrieval system