KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1959Help
Entry
VP1959            CDS       T00120                                 

Gene name
trpC, trpF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VP1959 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VP1959 (trpC)
Enzymes [BR:vpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VP1959 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VP1959 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2050238..2051683
Genome map
AA seq 481 aa AA seqDB search
MKMTDFNTQQANNLSEHVSKKEAEMAEVLAKIVRDKYQWVAERKASQHLSTFQSDLLPSD
RSFYDALSGDKTVFITECKKASPSKGLIRNDFDLDYIASVYNNYADAISVLTDEKYFQGS
FDFLPQVRRQVKQPVLCKDFMVDTYQVYLARHYGADAVLLMLSVLNDEEYKALEEAAHSL
NMGILTEVSNEEELHRAVQLGARVIGINNRNLRDLTTDLNRTKALAPTIRKLAPNATVIS
ESGIYTHQQVRDLAEYADGFLIGSSLMAEDNLELAVRKVTLGENKVCGLTHPDDAAKAYQ
AGAVFGGLIFVEKSKRAVDFESARLTMSGAPLNYVGVFQNHDVDYVASIVTSLGLKAVQL
HGLEDQEYVNQLKTELPVGVEIWKAYGVADTKPSLLADNIDRHLLDAQVGTQTGGTGHVF
DWSLIGDPSQIMLAGGLSPENAQQAAKLGCLGLDLNSGVESAPGKKDSQKLQAAFHAIRN
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgactgacttcaacacccagcaagcaaacaacttatcagagcacgtctcaaaa
aaagaagcagaaatggcggaagtgcttgccaaaattgttcgcgataaataccaatgggta
gcagagcgaaaagcatcacagcatctgagcacttttcagtcagatctattgccgtcggat
cgcagtttttatgatgcattgagtggcgataaaaccgtattcattacagaatgcaaaaag
gcatcgccatcaaaaggccttattcgcaacgacttcgatttggactacatcgcgtcggtt
tacaacaactacgcagacgcgatctcggttctgaccgatgaaaaatacttccagggtagc
ttcgattttctgcctcaagttcgccgacaagtgaaacagccagtgttgtgtaaggacttc
atggtcgatacctaccaagtttaccttgctcgtcattatggcgcggatgcggtattgctc
atgctttcggtactgaatgacgaagagtacaaagcgttagaagaagctgcgcacagccta
aacatgggcattttaacggaagtcagcaacgaagaagagcttcaccgcgcagttcagctt
ggagctagagttatcggaataaacaaccgcaacttgcgcgacttaacaacggatttaaac
cgcactaaagcgcttgcgccaaccattcgtaagcttgcaccaaacgcaacggttatttca
gagtctggcatttacactcatcaacaagttcgtgacttagcagaatatgcagacggcttt
ttgattggcagctcgctgatggcggaagacaacttagaacttgcggttcgtaaagtaacg
ctaggtgaaaataaggtttgcggtctgactcacccagatgatgcggcaaaagcgtatcaa
gcaggcgcagtatttggtggtctgattttcgttgagaaatcgaaacgagcggtcgatttt
gaaagtgctcgcctaaccatgagcggcgcgccacttaattatgttggcgtgttccaaaat
cacgacgttgattatgtcgcctctatcgtaacgtctttgggcttaaaagccgtacagtta
catgggctagaagatcaagagtacgtcaaccagctcaaaacagaactacccgttggcgtc
gagatttggaaagcctacggcgtggcggatacaaaaccatccttgctcgcagacaacatt
gaccgtcacctactggatgctcaagttggtactcaaactggcggcacaggccacgtgttc
gactggtctttgatcggcgatccaagtcaaatcatgctggcaggtggactgtcgcctgaa
aatgcacagcaagcagcaaaattaggctgcttgggattagatttaaactctggagtagaa
agcgcaccggggaaaaaagattcacagaagttgcaagccgcatttcacgctattcgcaac
tactaa

DBGET integrated database retrieval system