KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1960Help
Entry
VP1960            CDS       T00120                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VP1960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VP1960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VP1960
Enzymes [BR:vpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VP1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2051724..2052914
Genome map
AA seq 396 aa AA seqDB search
MAKLNAYFGEYGGQYVPQILVPALKQLEQAFIDAQEDPEFRSEFMTLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSGSY
EDAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEESVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDNVTDDEALEAFQELARSEGIIPALESSHALAHALRM
ARENPEKEQLLVVNLSGRGDKDIFTVHAILEEKGVI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgaatgcctactttggcgaatatggcggtcaatacgttccgcaaattcta
gttccagcacttaagcaactagagcaagcgtttattgacgcgcaagaagatccagaattc
cgcagcgagttcatgacgctccttcaagagtacgctggtcgcccaacggcactgactctg
actcgtaacctaaccaaaggcacaaaaacaaaattgtacctaaaacgtgaagatctgctt
cacggcggcgcacacaaaaccaaccaagtacttggtcaggcgctacttgcgaagcgcatg
ggtaaacacgaaatcatcgcagaaacaggcgcaggtcaacacggtgtagcaactgcactt
gcgtgtgcactacttggcctcaagtgtcgagtttacatgggtgcaaaagacgttgaacgt
caaagcccgaacgtgttccgcatgaaactgatgggtgcagaagtaattcctgtccattca
ggctcagcaacacttaaagatgcttgtaatgaagcgctgcgtgattggtcaggcagctac
gaagacgcacactaccttctcggtacagcagcaggccctcacccatttccaactattgtg
cgtgagttccaacgcatgattggtgaagaaactaaaaaccaaattctggcacgtgaaggt
cgcctacctgatgctgttatcgcctgtgtgggtggcggctcaaacgcgattggtatgttt
gcagattttatcgaagaagaaagcgttcgcctgattggcgtggaaccagcaggtaaaggc
atcgatacggatcaacacggtgcgccacttaagcatggtaaaacaggtatcttctttggt
atgaaggcaccattaatgcaagatgagaatggtcaggttgaagagtcttactctgtttca
gcaggtctagacttcccttctgttggtccacagcacgcacaccttaacgctatcggtcgc
gctgaatacgacaacgtaacggatgatgaagcattagaagcattccaagaactagctcgc
agcgaaggcatcattcctgcacttgaatcttctcatgctctggcacatgcactgcgtatg
gctcgtgagaatcctgaaaaagagcaattactggttgttaacctatctggtcgtggtgac
aaagacatcttcaccgtacacgccatcttagaagaaaaaggagtaatctaa

DBGET integrated database retrieval system