KEGG   Vibrio parahaemolyticus RIMD 2210633: VP1961Help
Entry
VP1961            CDS       T00120                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VP1961 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VP1961 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VP1961 (trpA)
Enzymes [BR:vpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VP1961 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2052914..2053720
Genome map
AA seq 268 aa AA seqDB search
MSRYEKMFARLNEKNQGAFVPFVTVCDPNAEQSYKIMETLVESGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFEQIGKIRAKYPDLPIGLLMYANLVYSRGIESFYERCAK
AGIDSVLIADVPTNESAEFVAAAEKFGIHPIFIAPPTASDETLKQVSELGGGYTYLLSRA
GVTGAETKANMPVDHMLEKLNQFNAPPALLGFGISEPAQVKQAIEAGAAGAISGSAVVKI
IEAHVEQPQIMLDKLGEFVSAMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttatgagaagatgtttgcacgcctaaacgagaaaaaccaaggcgcatttgta
ccattcgtgacggtttgtgatccaaacgccgagcaatcgtacaagatcatggaaacactg
gttgaatctggcgctgatgcgcttgaacttggtattccgttctcagacccattggcggac
ggcccaacaattcaaggtgccaacattcgagcgttagattcgggtgcaactccagatatc
tgttttgagcaaatcggaaaaattcgagcaaagtacccagacctgccaattggtctattg
atgtacgccaacctcgtatactcacgcggtattgagagcttctacgagcgctgtgcaaaa
gcgggcatcgattccgttctcattgcagacgttccgactaacgaaagcgcagagttcgta
gccgcggcagagaaatttggaatccacccaatctttatcgcaccaccaacggcaagtgac
gagacgctaaaacaagtttctgaattgggcggcggctacacttacctgctttcgcgcgcg
ggtgtgacgggtgcagaaaccaaagctaacatgccagttgaccacatgcttgaaaagcta
aaccagtttaatgcaccaccagcgttactaggtttcggcatttctgaaccagcacaagta
aaacaagccattgaagcgggcgctgcaggtgcaatttcgggttcagcagtcgtaaaaatc
atcgaagcacacgtagagcaaccgcaaatcatgctcgataagcttggtgaatttgtctca
gcaatgaaagcggcaactcaaaagtaa

DBGET integrated database retrieval system