KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2121Help
Entry
VP2121            CDS       T00120                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VP2121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VP2121
   00620 Pyruvate metabolism
    VP2121
   00650 Butanoate metabolism
    VP2121
  Lipid metabolism
   00071 Fatty acid degradation
    VP2121
  Amino acid metabolism
   00350 Tyrosine metabolism
    VP2121
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VP2121
   00626 Naphthalene degradation
    VP2121
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VP2121
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VP2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(2225700..2228402)
Genome map
AA seq 900 aa AA seqDB search
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDKIFRAASLAANQARIPLAQQAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEQTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASVLMSKTF
DNGVVCASEQAVIVVDEVYDEVKERFASHKAHVLSKTDADKVRKVLLIDGALNAKIVGQP
ATAIAEMAGVKVPADTKVLIGEGLGKVSYDDAFAHEKLSPTLGMFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKMKTARILINIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKR
AFLVTDRFLFNNGYADDVVSLLKAQGMEVQTFFDVEADPTLSVVEKGAAQMASYQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGANDPIAREKVHNAATIAGVAFANAFLGV
CHSMAHKLGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKVNLDIPMSIQAAGVAEADFVAKLDELAVEAFDDQC
TGANPRYPLISELKDVLLASYYGKAFVEGETFEGTTVIKKKADQEAAKSAPKAKKEKADA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcaatgattgctcgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagacaaaatcttccgtgcagcgtctctt
gcagctaaccaagctcgtatccctctagcgcaacaagcggtagaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccacttcgcttctgagtttatctacaacaaatac
aaagacgaacaaacgtgtggcatcctagaagaggatgacaacctaggtactatgactatc
gctgaacctgtaggtatcatctgcggtatcgtaccaacaactaaccctacatctacagcg
atcttcaaatctctaatctctctgaagactcgtaacggtatcatcttctcaccacaccca
cgtgcgaaaaactctactaacgatgcagcgaaacttgttctagatgcagcagtagcagca
ggtgcaccaaaagacatcatcggttggatcgaccaaccttcagttgagctatcaaacgct
ctaatgaaacacgatgacatcgcgcttatccttgcaactggtggtccaggcatggttaaa
gcagcttactcttctggtaagccagcaatcggtgtaggtgcaggtaacgttcctgtagtt
atcgatgaaacagcagacatcaaacgtgcagttgcttctgtactaatgtctaaaactttc
gataacggcgtagtatgtgcttctgagcaggctgtaatcgtagttgacgaagtttacgac
gaagtaaaagagcgttttgcttctcataaagctcacgttctatctaaaacagatgctgac
aaagtacgtaaagtgcttctaatcgacggcgcgctaaacgcgaaaatcgttggtcaacca
gctacagctatcgctgaaatggcgggtgttaaagttcctgcagatactaaagtgcttatc
ggtgaaggcctaggcaaagtatcttacgatgacgcatttgctcacgagaaactgtctcca
actctaggtatgttccgtgctgacaacttcgaagatgcagttgctcaagcagtaacaatg
gtagagatcggcggtatcggtcacacatctggtctatacactaaccaagacgtgaatgca
gaccgcatccgttacttcggtgacaagatgaagaccgctcgtatcctaatcaacatcccg
actacacacggtggtatcggtgacttgtacaacttcaacgttgcaccttctctaactcta
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgtagcgaagcgagctgaaaacatgttgtggcataaactacctaagtca
atctacttccgtcgtggtagccttccaatcgcacttggcgacctagaaggtaagaaacgc
gcattcctagtaactgaccgtttcctattcaacaacggttacgcagatgacgtagtaagc
ctactgaaagctcaaggcatggaagttcaaacattcttcgatgttgaagctgacccaaca
ctatctgtagtagaaaaaggtgcggctcaaatggctagctaccaacctgacgttatccta
gcgctaggtggtggttcaccaatggatgcagcgaaaatcatgtgggtaatgtacgagcac
ccagaaactcactttgaagaactagcaatgcgctttatggacatccgtaaacgtatctac
aagttccctaaaatgggtaaaaaagctgagcttgtatgtatcactacaacttcaggtact
ggttcagaagttactccattcgcagttgttactgacgacaagactggtgctaagtaccca
ctagctgactacgaaatcacgccaaacatggctatcgttgatgcgaacctagtaatgaac
atgcctaagtctctaacagcgttcggtggttacgatgcagtaactcacgctctagaagct
tatgtatctgttcttgcgaacgaatactctgacggtcaggctcttcaagcacttaagatg
ctaaaagaatacctaccatcaagctacgcgaatggtgcaaatgacccaatcgctcgtgag
aaagttcacaacgcagcaactatcgctggtgtagcatttgcgaacgcattcctaggtgtt
tgtcactcaatggcgcacaaactaggtgcagagttccacttgccacacggcctagctaac
gcactactaatctctaacgtggtacgttacaacgcgaacgacaacccaactaaacaaact
gcgttctctcaatacgaccgtccacaagcacgtcgtcgttacgctgaagttgcagaccac
ctaggcctaagccaagctggtgaccgcactgctcagaagattgaacgtctactagcatgg
ttggatgaactaaaagttaacctagacatcccaatgtctatccaagcggcaggtgttgct
gaagctgacttcgtagcgaaactagacgagctagcggttgaagcgttcgatgaccaatgt
actggtgcgaacccacgctaccctctaattagcgagctaaaagacgttctactagcttct
tactacggtaaagctttcgttgaaggtgaaactttcgaaggtactacagtaatcaagaag
aaagcagaccaagaagcagcgaaatctgctcctaaagctaaaaaagaaaaagctgacgcg
taa

DBGET integrated database retrieval system