KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2158Help
Entry
VP2158            CDS       T00120                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00010  Glycolysis / Gluconeogenesis
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VP2158
Enzymes [BR:vpa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VP2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF4352 DUF4766
Motif
Other DBs
NCBI-GeneID: 1189671
NCBI-ProteinID: NP_798537
UniProt: Q87MS3
Position
I:2270269..2271153
Genome map
AA seq 294 aa AA seqDB search
MDLKTLPPLTVLSDNVTVVEIDNVKIVRIIHDKATAGIALHGGHVVSYAPQGQEDLIWMS
EKAIFDGKAALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENENGVIVELALFPTE
ETHQIWPHMFDARLLVEVGDELKVTLKVLNIDDEAWTFSGALHTYLNVGDIKQAQTTGMG
NEYIDSLKNSEVCQGGEVLQLTDTIDRVYTQPEAQILVKDPVLNRTLSVANRGHNSAVLW
NPWAEGAQGMGDMADNGYETMLCVESALHAPSIEEGKTLEPGESYELVTVIAAQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaactcttcctcctctaactgttctttcagacaacgtaactgttgtcgaa
atcgataacgtaaagatcgttcgtattattcatgacaaagcgacagcaggtattgcttta
cacggcggtcatgtagtctcgtacgcaccacaaggtcaagaagacttgatctggatgagc
gaaaaagccatttttgatggcaaagcagcattacgtggtggcattcctgtttgttggcct
tggtttggccgtattgctgcaccagctcatggctttgcgcgtacatccgaatgggaatta
gttgagcaccgcgaaaatgaaaatggtgtcatcgtcgagttggcactattcccaaccgaa
gaaacacatcaaatttggccacacatgtttgatgcgcgtcttcttgtcgaagtgggtgac
gaactcaaagtaacgctgaaagttcttaatatcgatgatgaagcttggacgttctcaggc
gcattacatacttacctaaacgtgggcgatatcaaacaagcgcaaacaacaggtatgggc
aacgagtacatcgacagcttgaaaaatagcgaagtgtgtcagggtggtgaggttcttcaa
ctgactgacaccatcgatcgcgtatacacgcaaccagaagctcaaattttagtgaaagac
cctgttcttaaccgtacgttgagcgtagcgaaccgcggccataactccgcagtactatgg
aacccgtgggcggaaggtgcacaagggatgggagacatggctgacaatggctatgaaact
atgctgtgtgtggaatctgcccttcatgcgccaagtattgaagaaggcaagactcttgag
ccaggcgagagctacgagctcgtgacagtgattgctgcacaataa

DBGET integrated database retrieval system