KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2158Help
Entry
VP2158            CDS       T00120                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2270269..2271153
Genome map
AA seq 294 aa AA seqDB search
MDLKTLPPLTVLSDNVTVVEIDNVKIVRIIHDKATAGIALHGGHVVSYAPQGQEDLIWMS
EKAIFDGKAALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENENGVIVELALFPTE
ETHQIWPHMFDARLLVEVGDELKVTLKVLNIDDEAWTFSGALHTYLNVGDIKQAQTTGMG
NEYIDSLKNSEVCQGGEVLQLTDTIDRVYTQPEAQILVKDPVLNRTLSVANRGHNSAVLW
NPWAEGAQGMGDMADNGYETMLCVESALHAPSIEEGKTLEPGESYELVTVIAAQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaactcttcctcctctaactgttctttcagacaacgtaactgttgtcgaa
atcgataacgtaaagatcgttcgtattattcatgacaaagcgacagcaggtattgcttta
cacggcggtcatgtagtctcgtacgcaccacaaggtcaagaagacttgatctggatgagc
gaaaaagccatttttgatggcaaagcagcattacgtggtggcattcctgtttgttggcct
tggtttggccgtattgctgcaccagctcatggctttgcgcgtacatccgaatgggaatta
gttgagcaccgcgaaaatgaaaatggtgtcatcgtcgagttggcactattcccaaccgaa
gaaacacatcaaatttggccacacatgtttgatgcgcgtcttcttgtcgaagtgggtgac
gaactcaaagtaacgctgaaagttcttaatatcgatgatgaagcttggacgttctcaggc
gcattacatacttacctaaacgtgggcgatatcaaacaagcgcaaacaacaggtatgggc
aacgagtacatcgacagcttgaaaaatagcgaagtgtgtcagggtggtgaggttcttcaa
ctgactgacaccatcgatcgcgtatacacgcaaccagaagctcaaattttagtgaaagac
cctgttcttaaccgtacgttgagcgtagcgaaccgcggccataactccgcagtactatgg
aacccgtgggcggaaggtgcacaagggatgggagacatggctgacaatggctatgaaact
atgctgtgtgtggaatctgcccttcatgcgccaagtattgaagaaggcaagactcttgag
ccaggcgagagctacgagctcgtgacagtgattgctgcacaataa

DBGET integrated database retrieval system