KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2177Help
Entry
VP2177            CDS       T00120                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VP2177 (recR)
DNA repair and recombination proteins [BR:vpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VP2177 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2287435..2288034)
Genome map
AA seq 199 aa AA seqDB search
MRTSHMLEQLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSQSMTEIGHCAEC
RTFTEEEVCHICTNPKRQENGQICVVESPADIAAVEATGQYSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDISEVILATNPTVEGEATAHYIAELCREHQVEASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcatatgctggaacaattgatggaggccttacgttgtctacctggggta
ggtcccaagtcggcgcaacgtatggcctttcatttgttacagcgtgatagaaaaggcggt
ctgcaactggcagatgcgctgagtcagtcaatgaccgaaattggtcactgtgctgaatgt
cgaacttttactgaagaagaagtttgccacatttgtactaacccaaaacgccaagaaaac
ggccaaatttgtgtagtagaaagcccggcagatatcgcagcagttgaagcgacgggtcaa
tactccggtcgatactttgtgcttatggggcatttgtctccgcttgatggcatcggtcca
agtgatattggtttagacgtgcttgattatcgtctacgtcgaggtgatatttctgaagtg
atccttgcaaccaacccaacggttgagggagaagctactgctcactatattgcggagttg
tgcagagagcaccaagtcgaagctagccgtatcgcgcacggtgtgcctgtaggtggggag
cttgagcttgtagatggcacgaccttgtcacactcattattgggtcgacataagatttaa

DBGET integrated database retrieval system