KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2177Help
Entry
VP2177            CDS       T00120                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VP2177 (recR)
DNA repair and recombination proteins [BR:vpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VP2177 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2287435..2288034)
Genome map
AA seq 199 aa AA seqDB search
MRTSHMLEQLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSQSMTEIGHCAEC
RTFTEEEVCHICTNPKRQENGQICVVESPADIAAVEATGQYSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDISEVILATNPTVEGEATAHYIAELCREHQVEASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagtcatatgctggaacaattgatggaggccttacgttgtctacctggggta
ggtcccaagtcggcgcaacgtatggcctttcatttgttacagcgtgatagaaaaggcggt
ctgcaactggcagatgcgctgagtcagtcaatgaccgaaattggtcactgtgctgaatgt
cgaacttttactgaagaagaagtttgccacatttgtactaacccaaaacgccaagaaaac
ggccaaatttgtgtagtagaaagcccggcagatatcgcagcagttgaagcgacgggtcaa
tactccggtcgatactttgtgcttatggggcatttgtctccgcttgatggcatcggtcca
agtgatattggtttagacgtgcttgattatcgtctacgtcgaggtgatatttctgaagtg
atccttgcaaccaacccaacggttgagggagaagctactgctcactatattgcggagttg
tgcagagagcaccaagtcgaagctagccgtatcgcgcacggtgtgcctgtaggtggggag
cttgagcttgtagatggcacgaccttgtcacactcattattgggtcgacataagatttaa

DBGET integrated database retrieval system