KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2208Help
Entry
VP2208            CDS       T00120                                 

Gene name
fadJ
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00071  Fatty acid degradation
vpa00280  Valine, leucine and isoleucine degradation
vpa00281  Geraniol degradation
vpa00310  Lysine degradation
vpa00362  Benzoate degradation
vpa00380  Tryptophan metabolism
vpa00410  beta-Alanine metabolism
vpa00640  Propanoate metabolism
vpa00650  Butanoate metabolism
vpa00903  Limonene and pinene degradation
vpa00930  Caprolactam degradation
vpa01040  Biosynthesis of unsaturated fatty acids
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
vpa01200  Carbon metabolism
vpa01212  Fatty acid metabolism
Module
vpa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VP2208 (fadJ)
   00650 Butanoate metabolism
    VP2208 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    VP2208 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    VP2208 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VP2208 (fadJ)
   00310 Lysine degradation
    VP2208 (fadJ)
   00380 Tryptophan metabolism
    VP2208 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VP2208 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VP2208 (fadJ)
   00281 Geraniol degradation
    VP2208 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VP2208 (fadJ)
   00930 Caprolactam degradation
    VP2208 (fadJ)
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VP2208 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VP2208 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VP2208 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 1189721
NCBI-ProteinID: NP_798587
UniProt: Q87MM3
Position
I:complement(2320500..2322611)
Genome map
AA seq 703 aa AA seqDB search
MSEQKAFSLNVDEQNIAWLAIDVPNEKMNTLQAAFADEMKEIFAQLKDSSGIKGMIIHSL
KPDNFVAGADVRMLEACTTANEAQALAKQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTDFDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPDTILLDVAKQFIDKGKNKGKKKQSTKEKLMSGSGLGRKLVFEQAAKKTNQ
KTRGNYPATVAILEVIQHGLEKGFAQGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
HGTDAQPAAVKKVGVLGGGLMGAGISHVTVAKAKVPVRIKDVSNDGVLNALNYNYKLFEK
QRKRRILSKADLQAKMLQLSGGVDFTSYNHIDVVIEAVFEDLDLKQQMVADIEANAKSET
IFATNTSSLPIHKIAEKAERPENIVGLHYFSPVEKMPLVEVIPHETTSDETISTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEKLDGALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGERFKGPDVFDILLNDGRKGRKSGKGFYTYKGKKKEVDKSIYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNEFASKYGDRYAPCDGLLTRAGEGRTFY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtcttaacgttgatgagcagaacattgcatggttagcg
atcgacgtaccgaatgaaaagatgaacacgctacaggcagcttttgctgatgaaatgaaa
gaaatttttgctcagctaaaagactccagtggcatcaaagggatgatcattcactcctta
aaaccggataattttgtggcaggtgccgatgttcgtatgttggaggcatgtaccacagcg
aatgaagcacaagcattggcaaaacaaggtcaagagttgttccaacaactgtctgactta
ccttaccctgtagttgcggctattcatggcccatgtttggggggcggtttagagcttgcg
cttgcatgtgattaccgtgtttgtacggatttcgataagacacgcttaggcttaccagaa
gttcaactcggtctattaccgggctctggcggtactcagcgtttgccacgtttgattggt
ctgttaccgtcattggacttgatcctgacgggtaaacagcttcgcgcgaagaaagccaaa
aaactgggcgttgtggacgcgtgtgtccctgacaccattttgctcgacgtcgcaaaacag
tttatcgacaaaggcaagaacaagggcaagaaaaagcaatcgacgaaagagaagttgatg
tcgggcagtgggttaggtcgtaagcttgttttcgaacaagctgcgaagaaaaccaaccag
aagacccgtggcaactatccagcaacggtcgcgattcttgaagtgattcaacacggtctg
gaaaaaggctttgcacaagggcaagagcttgaagcgaaacgatttggtgagcttgtgatg
agctccgaatcgaaagcattgcgctctatctttttcgcgactactgaaatgaagaaggaa
cacggcacggatgcacagccagcagcggtgaaaaaagtgggtgttcttggtggcggctta
atgggcgccgggatcagtcatgtaacggtagctaaagcaaaagtgcctgttcgaatcaaa
gatgtgagcaatgacggtgtgttgaatgcgcttaactacaactacaagttgtttgagaag
cagcgtaaacgtcgcatcctgtcgaaagccgatttacaggcgaagatgttgcaactgtct
ggtggcgtagactttacaagttacaaccacattgatgttgtgatcgaagcggttttcgaa
gacttggatctaaaacaacagatggttgcggacattgaagcaaacgcaaaatctgaaact
atttttgctacgaacacgtcttcgttaccaatccacaagattgcagaaaaggcagagcga
ccagaaaacatcgtcggtttacattactttagcccagtagaaaaaatgccgctggtggaa
gtgattccgcatgaaacaacgtctgatgaaaccatttcgacagttgtcgcattggctaag
aagcagggtaaaaccccaatcgttgtgaaggacaaagctggcttttacgtaaaccgcatt
cttgcgccttacatgaatgaagctgcgcatatcttgctggcaaatgagccgattgagaag
ttagatggtgcgttgttggatttcggcttccctgttgggccaatcacgttacttgatgaa
gttggtgttgatattggcgcgaagatcatgccgattctagtcaatgagttgggcgagcga
ttcaaaggtcctgatgtattcgatatcttattgaatgacggtcgcaaaggacgcaagagc
gggaaaggtttctacacttacaaaggtaagaagaaagaagtcgataaatccatctacaag
ctactcaaactgacgccagaatcgaagctcagcgataacgatattgcgttgcgctgtgta
ctgccaatgcttaatgaagcagtacgatgcttggacgacggtattattcgctctccgcgc
gatggcgatattggtgcgatttttggtattggcttccctccattccttggcgggccattc
cgttatatggatcaattcggtttgaaagaactggttgagaaaatgaacgaatttgcatcg
aaatatggcgatcgttatgcgccatgcgacggactgctgactagagcgggtgaaggtcgt
accttctactaa

DBGET integrated database retrieval system