KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2312Help
Entry
VP2312            CDS       T00120                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00900  Terpenoid backbone biosynthesis
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01130  Biosynthesis of antibiotics
Module
vpa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VP2312
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     VP2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 1189825
NCBI-ProteinID: NP_798691
UniProt: Q87ME3
Position
I:complement(2424712..2425917)
Genome map
AA seq 401 aa AA seqDB search
MQKLTILGATGSIGASTLKVVEQNPELFSVVALAAGTNVEKMVALCRQWQPKFAVMADKA
AAVALQSEIHTISPNTEVLGGVDALCHVASLEEVDSVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGQLFIDAVEQYGAELLPVDSEHNAIFQCLPQQVQTNLGRCNLDEHGISS
ILLTGSGGPFRYADIADLDSVTPAQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFN
AARDQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDMATPIALTMSYPSRVDAGVKPLDFT
QVGELTFLQPDFARYPCLKLAIDACYEGQHATTALNAANEVAVDAFLNNRLGFTDIARIN
ELVLHKITASCKPENANSLESLLELDRMSRTIALEIIRERS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttaacgattcttggtgcaacaggctcaataggtgcaagcaccttaaaagtg
gttgaacaaaacccagagctgttttctgtggtcgcactagcggctggcactaacgttgaa
aagatggtggcactttgtcgccaatggcagcctaaattcgcggtaatggcggataaggct
gcggctgttgctctgcaatcagaaatccacaccatttcaccaaatacagaagtgttaggt
ggtgttgatgcactttgtcatgtggcttcattagaagaagtagatagcgtaatggcagcc
atcgttggtgcagcgggtttgttgccaaccatggcggccgttaaagcgggtaagcgcgta
ttgctggcgaataaagaagcgcttgtcatgtctggacagttgtttattgatgccgttgaa
caatacggggcagagttgctgccagtagacagtgaacataatgctattttccagtgccta
ccacagcaagttcaaaccaatcttggccgctgtaacttagatgagcatggcatttctagt
attctgttaaccggatctggcggtccattccgttacgctgacattgccgatctcgacagc
gtaacgccagcacaggcaatcgcgcaccctaactggtctatggggccaaagatttcggtc
gattctgcgactatgatgaataaaggtcttgagtacattgaagcaaaatggctattcaat
gcggctcgtgaccagttaaaagtgattattcacccgcaatccgtgatccattcaatggtt
cagtatcgtgatggttcggtactggcgcaaatgggagagccagatatggcaacaccaatt
gcgttgacaatgtcttatccttctcgtgttgatgccggtgtaaaaccgctagactttact
caagtaggtgaattgacattcttgcaaccagactttgctcgttatccttgtttgaagctt
gcgattgacgcgtgttacgaagggcaacatgcgactactgctctaaatgcagccaatgaa
gttgctgttgatgcgtttctaaataatcgccttggttttacagacatagctcgcatcaat
gaattggttttgcataaaatcaccgcaagctgcaaacctgagaatgcgaatagcttggaa
agcttgctagagctcgatagaatgtctcgaactatcgccctagaaattatacgcgagcgt
agctaa

DBGET integrated database retrieval system