KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2397Help
Entry
VP2397            CDS       T00120                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vpa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2514277..2515308)
Genome map
AA seq 343 aa AA seqDB search
MAQTPSFDGQTANLIHLTNANGMTASFMDIGATWLSCTLPVNGENREVLLRSPNMAEHMK
QDAYFGSIVGRFANRIAKGQFEIDGEKYQLGINNGENSLHGGLEGFDKRRWKVEEQNDQQ
VTFSLRSPDGDQGYPGNLYVKVTYTLTDENELAIAYDAKTDKTSPVNLTNHAYFNLAGEA
SRAKSLDHTLQLNAGHYLPTDAGLIPTGEQKPVLGTSFDFTEPKSIGQEFLAEQDQKTAG
GYDHAFVFMPEVTDGVSVTAVLIAPKEDVVMKVKTTKPAIQFYSGNFLAGTPGASKTYER
YDGLALETQYFPDGPNKPEWGLNNGVLSSGDCYQHQTTYQFEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaacgccgtcgtttgatggccaaactgcgaatctgattcatttgaccaacgcg
aatggtatgacagcgtcgtttatggatatcggtgcgacgtggttgagttgcacattaccg
gtaaatggtgaaaaccgtgaagtgttgttgcgctcaccaaatatggctgaacacatgaag
caagacgcttacttcggttccattgttggccgctttgctaaccgaattgcgaaggggcag
tttgagatagacggagagaagtatcaacttggtatcaataacggtgaaaactcactgcac
ggtggcctagaagggtttgataaacgccgctggaaggttgaagagcaaaatgatcaacag
gtcactttttcacttcgctcaccggacggtgaccaaggctatccgggaaacctctatgtg
aaggtgacgtacacgctcactgacgagaatgaactggctatcgcctatgatgctaagacc
gacaaaacatcaccagtgaatttaaccaatcacgcctactttaacttggctggtgaggcg
agccgcgcgaaaagtttggatcatactttacagctcaatgctgggcattacttgccaacg
gatgcggggttaattcctaccggtgaacaaaagccagttttgggtaccagtttcgacttc
accgagccaaaatcgataggccaagaatttcttgccgagcaagatcagaaaaccgctggt
ggctacgatcacgcctttgtattcatgcctgaagtgaccgatggcgtgtctgtcactgcg
gttttaattgcaccaaaagaagatgtggtgatgaaggtgaaaaccaccaagcctgccatc
cagttttattcaggtaatttcttagccggtacgccaggtgcaagtaaaacttacgaacgc
tatgacggccttgcgttggaaacgcagtactttccagacgggccaaacaaaccagaatgg
ggactcaacaatggggtgttgagctctggggattgctatcagcatcaaactacttatcag
tttgaattttag

DBGET integrated database retrieval system