KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2403Help
Entry
VP2403            CDS       T00120                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vpa00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vpa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2520491..2523589
Genome map
AA seq 1032 aa AA seqDB search
MNNWENFQHLHENRMAPRAYFFSYDSVQSAQTFQRELSRRFMLLSGQWTFRYFTNPMLVP
DEFYSQTMNDWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWDNQQTIIKFDGVETYFEVYVNGEYVGFSKGSRLTAEFDISKFVQQGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLIGKENIHVQDLTIRTDFADDYQSATLSAQIELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNHHSTSFAIDMVSPTHWTAENPYLYHLFIT
LKDHQGNVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLILMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLSRITNDPA
WEAVFVDRAVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYTATKAIDDTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHDHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPAPGLKEYKQVI
APVKIRAVEGCHDRFIVENKLWFTNLDDYTITADVRAEGETLRSVQFKVEALVANSEREV
TIDLPELDEREAFVNFTVRKDSRTLYSEANHEIAVYQFQLKDNTATLPALVNNNVQPLVL
EESRLEHVITGHNFALTFSKVNGKLTSWRVNGEEIIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIMQEHFRTLAVEATDDSVLITTTSIIAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGSFDQVSYYGRGPEENYQDSRQANLIDVYHSTVEDMFEN
YPFPQNNGNRQHVRWASLTNRHGTGLLVKPQQEINFSAWFYTNQNLHEAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVLDSYRVYMDEFRYGLTLMPLQAGNCNAHVMANHDFDNAF
FTQTNTQPVNEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaattgggaaaacttccaacacttacacgagaatcgtatggcaccgcgtgcgtac
tttttctcctacgactctgttcagagcgcacaaacctttcaacgtgaactgagtcgccgc
tttatgttgctcagcggccaatggacattccgttatttcaccaacccaatgttggtacct
gatgagttttactcacaaacaatgaacgactggggacacattaccgtcccaaacatgtgg
caaatggaaggccacggcgatctgcaatacaccgatgagggcttcccattcccgatcgac
gtcccgtttgtaccaaccgacaacccaacgggcgcttatcaacgcacatttacacttggt
ccacagtgggataaccaacaaaccatcatcaagttcgacggcgtggaaacctactttgaa
gtgtacgtaaacggcgagtacgtcggctttagcaaaggcagccgactcacagcggaattc
gacatttccaagttcgtccaacaaggcgaaaacttactctctgtacgcgtgatgcagtgg
gccgattccacttacattgaagaccaagacatgtggtggacggcggggatcttccgtgac
gtttacctaatcggaaaagagaacattcacgtccaagacctaacaattcgcaccgacttc
gccgacgattaccaaagtgcgacgctcagtgctcaaatcgaattggaaaacctttccacc
gctatcgcgtctggctatacgctggaatacgcgctgcatgacaaaggcactgtcgtagcc
agtggtcaatgcgattcactgactatccaaaaccaccactcaacaagctttgcgattgat
atggtgagcccaacacattggacggctgaaaacccttacctttaccacttgttcatcacc
ttaaaagatcaccaaggcaacgtagtggaagtgatcccacaacgcgtgggtttccgtgac
atcaaagtgcgcgatggcctgttttacatcaacaatcaatacgtgatgctgcatggtgtc
aaccgtcatgacaacgaccacctaaaaggtcgcgcagtgggcatggaccgcgtggaaaaa
gatctgattttgatgaagcaacacaacatcaactcggttcgcaccgcacactacccgaac
gacccacgcttctacgagttgtgtgatatttacggcctgtttgtgatggcagaaaccgat
gtggaaacccacggctttgccaacgttggcgacctgagccgtatcaccaatgatccagca
tgggaagcggtgtttgttgatcgcgcagtgcgccatgtgcacgcacagaaaaaccaccct
tctatcatcatgtggtcactcggtaacgaatcgggttatggctgtaacatccgtgcgatg
tataccgcgaccaaagcaattgatgacacccgtttggttcactacgaagaagaccgcgat
gctgaagtcgtcgatgtgatttcgacgatgtactcacgcgctcaactgatgaattacttt
ggcgaacacccacacgagaagccacgcatcatctgcgaatacgcacacgcgatggggaac
gggccgggtggtttaaccgaataccaaaacgtgttctatgcgcacgaccacattcaaggt
cactacgtttgggaatggtgtgatcacggcattctagcgcgtgatgaacacggtcaagag
ttctacaaatacggcggcgattacggcgactacccaaacaactacaacttctgcatggat
ggtctgatttacccagatcaaaccccggccccaggtctcaaagagtacaaacaagtcatt
gcaccggtgaaaatccgcgccgttgaaggttgccatgaccgctttatcgttgagaacaaa
ttgtggttcactaacctcgatgattacaccattactgctgacgtgcgtgccgaaggtgaa
accctgcgtagcgtgcaattcaaagtcgaagctttggtcgccaacagcgaacgtgaagtg
accatcgacttgccagaattggatgagcgcgaagcctttgtgaacttcaccgtacgcaaa
gacagtcgcacgctttacagcgaagccaaccatgaaattgcggtgtatcagttccaactg
aaagacaacaccgcgacgttgcctgcgttggtcaacaacaatgttcaacccttggtgctt
gaagaaagccgcctagagcacgtgatcacaggtcataactttgcgcttactttctccaaa
gtaaacggcaagctgacttcttggcgcgtaaatggcgaagagatcattcaatctgagccg
agactgaacttcttcaaaccgatgattgataaccacaaacaagagtatgaaggtttgtgg
cacccagcgcatctgcaaatcatgcaggagcacttccgcacacttgctgtggaagcaact
gatgattccgtcttgattacgaccaccagcatcattgcgccgccggtctttgattttggc
atgcgttgtacctatcgctatcaaatcaatgctcaaggccatttgaacgtggaactgagt
ggcgagcgctacggcgactaccctcacgtgattccggtcatcggcttggatttgggcatc
aacggcagctttgatcaagtgagttactacggtcgcggccctgaagaaaactatcaagac
agccgccaagctaacctcattgatgtttaccacagcaccgtcgaggacatgttcgagaac
tacccgttcccgcaaaacaacggcaaccgccaacacgtgcgctgggcctcactcaccaac
cgtcatggcacagggttattggtgaaacctcagcaagaaatcaacttcagcgcgtggttc
tacaccaaccaaaatctgcatgaagcgcaacatacgatcgagctagaaaagagtggctac
atcaccctcaaccttgaccatcaagtgatggggttaggctcgaactcatggggcagcgaa
gtgctcgactcttaccgcgtgtacatggacgagttccgttacggtttgacgctgatgcca
ctgcaagcaggcaattgcaacgcacacgtgatggcaaaccatgatttcgacaacgcgttt
ttcactcaaaccaatactcaaccagtcaacgaggcgtaa

DBGET integrated database retrieval system