KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2442Help
Entry
VP2442            CDS       T00120                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vpa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vpa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vpa03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vpa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2563629..2564027)
Genome map
AA seq 132 aa AA seqDB search
MSINEKQYLHEMGITSWELIHPERLAGYQPPTIDLPSSCKLLLVSPICPTNETAILFEKI
LKSMKLTLEQAMHIEPERLAMLGEHQLEWVWFAGCESNSMENAKQLTSPLLQDIDGNNEQ
KRALWQQICSYS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaacgagaaacagtatttacacgaaatgggaatcacctcgtgggagttgatt
catccagaaaggttggcaggctatcaaccgccaactatagatttgccaagttcttgcaaa
cttctgctggtctcacccatctgtcctacgaatgagacagcgatactgttcgagaagata
cttaaaagtatgaaattaacgcttgaacaagccatgcatatcgagcctgagcgccttgca
atgcttggtgaacatcagttggagtgggtatggtttgcaggctgtgaaagtaacagcatg
gaaaatgctaagcagctaacctcgccgttattgcaagacattgatggcaacaatgaacaa
aagcgcgcactttggcagcaaatttgttcttactcgtaa

DBGET integrated database retrieval system