KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2486Help
Entry
VP2486            CDS       T00120                                 

Definition
(RefSeq) beta-N-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00511  Other glycan degradation
vpa00520  Amino sugar and nucleotide sugar metabolism
vpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VP2486
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VP2486
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VP2486
Chaperones and folding catalysts [BR:vpa03110]
 Intramolecular chaperones
  Others
   VP2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 1190001
NCBI-ProteinID: NP_798865
UniProt: Q87LX2
Position
I:2618150..2620069
Genome map
AA seq 639 aa AA seqDB search
MEYRVDLVVLSEQKQNCRFGLTFHNLSDQDLHNWSLIFAFDRYILPDSISNGQLKQIGSY
CTLKPEGLVLAANHHFYCEFSIGSNPFRYYSDGFNEALVNFEVNGNLQRAQVDVTPIVLA
SPYRERSEIPSSLTHAQPLLPKPNHIEVSDHCFSFNHHAGVAVYSNLANSAKEWLLEELK
RIHQFEFASDNGSQIIFKGNPTLDEGAYKLKVAEESIKIEAGSSSGFTHACATLLQLIKV
GDQPASMEVVCCSIKDRPRFRYRGMMLDCARHFHSVEQVKRLINQLAHYKFNTFHWHLTD
DEGWRIEIKSLPQLTDIGAWRGLDETNEPQYTHLAERYGGFYTQEDIKDVVAFASKRGIT
VIPEIDVPGHCRAAIKSLPHLLVEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEV
SALFPAPYVHIGADEVPNGVWSKSPACQALMEQLGYSDYKELQGHFLRHAEDKLRKLGKR
MLGWEEAQHGDKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPG
VDWANPLPLEKTYNYEPLAEVPADDPIRKRIWGIQTALWCEIINNQSRMDYMVFPRLTAM
AEACWTDKQHRDWTDYLSRLKGHLPLLDLQGVNYRKPWK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgtgttgatctcgtcgtcctatcagaacaaaagcaaaactgccgtttcgga
ctgactttccataatttgagcgatcaagatctccacaattggagcctgatttttgctttt
gatcgctacattctgccggatagtatttcgaatggtcagctcaagcaaattggcagctac
tgcaccctcaaaccagaagggttggtgctggcagctaaccatcatttttactgcgagttc
agtattggttcgaacccattccgttactattctgatggattcaatgaagccttggtcaac
tttgaagtcaacggcaaccttcagcgagctcaagtcgatgtcacgccgatcgtattggct
tcaccgtaccgtgaacgtagtgagatcccttccagcttgacgcatgcgcagcctttgttg
ccaaaaccaaaccatatagaagtcagcgatcactgctttagctttaatcatcacgccggc
gttgcggtttattcaaacctagccaattcagctaaagagtggttacttgaagagcttaag
cgcattcatcaatttgagttcgcatcagacaatggcagtcagatcatcttcaaaggcaac
ccaaccttggatgaaggcgcttacaagctgaaggtagcagaagagtcgatcaaaattgaa
gcaggctcttcgtctggttttacccatgcttgtgcaacgttattgcaactgatcaaagtt
ggcgatcaaccagcctcaatggaagtggtttgctgttcaatcaaagaccgaccacgtttt
cgttaccgcggtatgatgctagattgtgctcgccattttcactccgttgagcaagtcaaa
cgtttgatcaaccagttggctcactacaagttcaatacattccattggcaccttaccgat
gatgaaggttggcgaattgagatcaaatcattgcctcaactaaccgatattggcgcatgg
cgtgggttggatgaaaccaatgagccacagtacacgcaccttgctgagcgttacggcggt
ttttacactcaagaagacatcaaagacgtggttgcatttgcttctaaacgaggcatcact
gttatccctgaaatcgatgtaccaggccactgccgagctgccatcaagtcgttaccacac
ctattggtagaagcagaagataccactgaataccgcagcattcagcattacaacgacaat
gtcattaacccagctctgccggggagctatgagtttatcgataaagtgttggaagaagtc
tccgcgttgttccctgccccttatgtccatatcggtgcggatgaagtacctaacggcgta
tggtcaaaaagcccagcgtgccaagcactaatggaacaactgggttacagcgactacaaa
gagttacaagggcacttcttgcgtcatgccgaagacaaactgcgcaaacttggcaagcgc
atgctgggttgggaagaagcacagcatggcgacaaagtcagcaaagacacagtgatctat
tcgtggctaagcgaagaagcggcgttgaactgcgcgcgccaaggtttcgatgtggtgcta
caaccagcgcaaaccacctacttagatatgacccaagattacgcaccagaagaaccgggc
gtggattgggctaacccgttgccgctagaaaaaacttacaactatgaaccactcgctgaa
gtgccagccgacgatccaatacgtaaacgcatttggggcattcaaaccgcattgtggtgt
gaaatcatcaacaaccagtctcgtatggactacatggtcttcccgcgcttaaccgcaatg
gcagaagcatgttggacagacaaacaacaccgagactggaccgactatttatcacgtttg
aaaggacacctaccgctgcttgatttgcagggagtgaattaccgtaaaccgtggaagtaa

DBGET integrated database retrieval system