KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2505Help
Entry
VP2505            CDS       T00120                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VP2505
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VP2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2644396..2644881
Genome map
AA seq 161 aa AA seqDB search
MITAYIAVGSNLADPVNQAQQAIEALKTLPNSEFVQASSLYSSTPMGPQNQPDYINAVVA
IKTNLTPLELLDCTQAIEQEQGRVRKDERWGPRTLDLDIVLYGNEVINSERLIVPHYGMR
EREFVLYPLAEIAPSLQLPDGTEVSELLEQVDKNGLRIWQS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagcgtacattgcggtaggcagtaacttggctgatcctgtcaaccaagctcag
caagcgattgaggctctaaaaacgttaccaaactctgagtttgtacaagcgtcttcgcta
tacagcagcacgcctatggggccacaaaatcagccggattacatcaatgcggttgtggcg
atcaaaacaaatttgacgcctcttgagctacttgattgcacccaagcaattgagcaagag
caagggcgtgtccgaaaagacgaacgttggggaccaagaaccttggatcttgatatcgtt
ctttacggcaatgaggtgattaattccgaaagacttattgttcctcattacggaatgcga
gagcgcgaattcgtactctaccctcttgcggaaattgcaccaagtttacaactccctgat
gggaccgaggtctctgaactactggaacaagtagataaaaacggcctcagaatttggcag
tcatag

DBGET integrated database retrieval system