KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2555Help
Entry
VP2555            CDS       T00120                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VP2555 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 Methyltransf_23 DREV Methyltransf_11 NodS GCD14 Methyltransf_32 CMAS
Motif
Other DBs
NCBI-GeneID: 1190079
NCBI-ProteinID: NP_798934
UniProt: Q87LQ6
Position
I:complement(2699788..2700414)
Genome map
AA seq 208 aa AA seqDB search
MSNPHADRLIAFLISSGIKDQRVLDAMHCLPRESFVSQAMMHQAYDNNALPIGQGQTISQ
PYIVARMTELLELQRASNVLEIGTGSGYQTAVLAQIVDHVYSVERIKSLQWEAKRRLKQL
DIYNVSTKHGDGWLGWETKGPFDAIIVTAAAEVIPQALLSQLKDGGKMVIPVGDAEQQLL
RIERKGDEYLSTVVEMVRFVPLVAGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacccacatgctgacaggttgatagcgtttcttatctccagtggcatcaaagat
caacgcgttttggatgcaatgcattgtttaccgagagagagctttgtttctcaagcgatg
atgcaccaagcctacgataacaatgcgctaccgattggtcagggacaaactatttctcaa
ccttacatcgtcgctcgcatgaccgagctgcttgagcttcaacgtgctagtaacgttttg
gaaatcggaaccggttctgggtaccaaaccgcagttttagcacaaatcgttgaccatgtt
tattccgttgaacgcatcaaatctttgcaatgggaagcgaaacgtcgtcttaagcaactt
gatatctacaatgtctcgacgaagcatggtgatggctggttaggatgggaaacgaaaggt
ccgtttgacgccatcattgttaccgctgctgcagaagtgattccccaagcgcttctctca
cagctaaaagatggcggtaaaatggtgattcctgtcggagatgctgagcagcaactactt
agaattgaacgcaagggtgacgagtacctttctaccgttgtggaaatggttcgctttgtt
cctcttgtcgcgggtgatttggcttaa

DBGET integrated database retrieval system