KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2711Help
Entry
VP2711            CDS       T00120                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VP2711
   00052 Galactose metabolism
    VP2711
   00500 Starch and sucrose metabolism
    VP2711
   00520 Amino sugar and nucleotide sugar metabolism
    VP2711
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VP2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2866528..2867400
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEEGVLAQMVALFKQFRCSIVAVQEVPADETHKYGVISGEMIKDD
IYRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNYCFENLYLKDEKKSELGKHATKKEV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtctgttccctgctgcaggctatggcacgcgctttcttccggcgaca
aaatcaatgccaaaagaaatgatgccagtagtgaacaaaccgttgattgaatacggcgtt
gaagaggcaattcaagctggtatgaacggtatgtgtattgtgacaggccgtggcaaacac
tcaatcatggatcactttgataagaactacgagcttgagcaccaaattagcggtaccaac
aaagaagagttacttgtcgatattcgtgagatcattgaatcagcgaactttacctacatt
cgccaacgtgaaatgaaaggtctaggtcacgcgattctaacgggtcgtgaactggttggt
gatgaacctttcgctgtagtacttgccgatgacttgtgtgtgaacgaggaagaaggcgtt
cttgctcaaatggttgcgctgtttaagcaattccgctgttctatcgtggcagtacaagaa
gtacctgctgatgagacgcacaaatacggcgtgatttctggtgaaatgatcaaagatgac
atctaccgcgtagatgacatggtagaaaaaccagaaccaggcacagcgccaagcaatctt
gcgatcattggtcgttacatccttacccctgatatttttgaactgatcgaaaacacagag
ccaggtaaaggtggtgaaatccaaattacggatgcgctgctgaaacaagcaaaagcaggt
tgtgttctcgcatataaattcaaaggtaagcgctttgattgcggtagcgtagaaggctac
attgaagcaacaaactactgtttcgaaaacttgtacctaaaagatgaaaagaagtctgaa
ttaggtaagcacgcaacaaagaaagaagtgtaa

DBGET integrated database retrieval system