KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2855Help
Entry
VP2855            CDS       T00120                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00010  Glycolysis / Gluconeogenesis
vpa00030  Pentose phosphate pathway
vpa00051  Fructose and mannose metabolism
vpa00052  Galactose metabolism
vpa00680  Methane metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
vpa01200  Carbon metabolism
vpa01230  Biosynthesis of amino acids
vpa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VP2855 (pfkA)
   00030 Pentose phosphate pathway
    VP2855 (pfkA)
   00051 Fructose and mannose metabolism
    VP2855 (pfkA)
   00052 Galactose metabolism
    VP2855 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VP2855 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VP2855 (pfkA)
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VP2855 (pfkA)
Protein phosphatases and associated proteins [BR:vpa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VP2855 (pfkA)
Messenger RNA biogenesis [BR:vpa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VP2855 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 1190418
NCBI-ProteinID: NP_799234
UniProt: Q87KX0
Position
I:complement(3021987..3022949)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSD
VINKGGTFLGSARFPEFKQVEVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTVGYLSALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKDKLISNIQDGIAKGKKHAIIALTELMMDANELARDIEAATG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLLEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLYKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttaacaagtggcggtgacgcacctggtatgaacgctgct
atacgcggcgtagtacgtacagcactatccgagggattggaagttttcggtgtgtacgac
ggctacctaggcctatacgaaggccgcatcgagaagctagatcgttctagcgtttcagat
gtgatcaacaaaggtggtacgttcctaggttctgcacgtttccctgaatttaaacaagtg
gaagtgcgtgaaaaagcgatcgagaacctaaagaaacatggtattgatgcgctagtcgtg
atcggtggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtcttccaggcacaatcgataacgatatcgctggtactgactacacagtgggttac
ctaagtgcactaaacacagttatcgatgcaatcgaccgtctacgtgatacttcttcttct
caccaacgtatttcaattgtagaaatcatgggccgtcactgtggtgacctaactctgatg
tctgcaatcgcgggtggttgtgagtacatcatcactccagaaactggtctagataaagac
aagctgatcagcaacatccaagacggcatcgcaaaaggtaagaaacacgcaatcatcgcg
cttactgagctaatgatggatgcaaatgaactggctcgtgacattgaagcggctacaggt
cgtgaaactcgtgcaacagtacttggtcacatccaacgtggtggtcgtccaactgcattt
gaccgcgttttagcatctcgcatgggtaactacgctgttcacctactgcttgaaggtcat
ggcggtcgctgtgtcggtatcgtgaaagagcaacttgttcaccacgacatcatcgacgcg
atcgaaaacatgaagcgtccagtgcgtaacgatctatacaaagttgctgaagaactgttc
taa

DBGET integrated database retrieval system