KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0180Help
Entry
VPA0180           CDS       T00120                                 

Definition
phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(176615..178006)
Genome map
AA seq 463 aa AA seqDB search
MIEFPDNFLWGGAIAANQVEGAYNLGGKGLSTSDMLPNGILSPHQTREERTPGIKDLAID
FYNRYPEDITLFKEMGFTCLRLSIAWSRIFPNGDELEPNEEGLAFYDKIFDELAKHDMQP
FVTLSHYEMPYALVENYGGWGDRRVIEFFERYAKTVLERYKDKVKLWLTFNEINMSLHAP
FTGVGLPEDATEQQIYQAIHHQLVANAKAVKLCQEIVPNGKIGNMLLGAMNYPYTCNPDD
VLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGIEIQMQDGDLEDIASASVDFISFSY
YASGCASADPKQKEVGNIVESVPNPYLEKSQWGWLIDPKGLRILLNFLHDRYQKPLFIVE
NGLGARDEFDENGEIQDDYRIAYLNDHLVQAHEAILDGVELMGFTSWGPIDLVANSTAEM
SKRYGYIYVDRHDDGQGTLERKRKKSFYWYQDVIRTAGGSLKR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtttccagataatttcctttggggtggtgccattgctgcaaaccaagtagag
ggtgcatacaaccttgggggtaaaggtttatcaacatcagatatgttgccaaacggcatt
ctgagcccgcatcaaacgcgtgaagaacgaacaccaggtatcaaagatcttgcgatcgat
ttctacaatcgctatccagaagatattactttgtttaaagagatgggattcacctgcctg
cgcttgtccatcgcttggagtcgtatttttcctaatggcgatgaactggagccaaacgaa
gaaggactggcgttttacgacaaaatttttgatgagctagccaaacacgacatgcaacca
tttgtgacgctttctcattacgagatgccttacgccttggttgaaaattatggtggttgg
ggcgatcgtcgagtgatcgagtttttcgagcgttacgctaaaaccgtgttagaacgctac
aaagataaggtcaaactgtggcttaccttcaacgaaatcaacatgtctctgcatgcacca
tttactggggttggtttgccagaagacgcaacagagcaacagatttaccaagcgattcac
catcaattggtggcgaatgctaaagcagtgaagctgtgccaggaaattgtaccgaatggc
aaaatcggcaacatgttactgggtgcaatgaactacccatacacttgtaaccctgatgat
gtgttagccgccatgcatgaaaacaacaagtggttgttcttcggtgacgtgcaaactcgt
ggtcagtaccctggctatatgaagcgctatttccgtgaaaatggcatcgaaattcagatg
caagacggtgatttagaagacattgcctcggccagtgtcgactttatctccttcagctac
tacgccagtggctgtgcgagcgcggatccgaaacaaaaggaagtcggcaatattgttgag
agcgtgccaaatccatatttggaaaagagccaatggggctggttgatcgatcccaaaggt
ctgcgtattttgctgaacttcttgcacgatcgctaccaaaagccgctctttatcgtggaa
aatggtttgggagcgagagatgaatttgacgaaaatggcgaaattcaagatgactaccgc
attgcctacctcaacgatcacctagtgcaagcgcacgaagccattcttgatggcgtggaa
ttaatgggtttcaccagttgggggccgattgatttagtagccaactcaacggcagaaatg
agcaagcgttacggatatatctacgttgatcgtcacgatgatggacaaggcactttagaa
cgtaaacgcaaaaagagcttctactggtatcaggatgtgattcgtaccgcaggtggttcg
ttaaaacgctaa

DBGET integrated database retrieval system