KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0201Help
Entry
VPA0201           CDS       T00120                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPA0201
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPA0201
   00630 Glyoxylate and dicarboxylate metabolism
    VPA0201
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VPA0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:202416..203000
Genome map
AA seq 194 aa AA seqDB search
MTMNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLESGSHQD
VSSYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDDSGNHVEVLFGCHK
GTGCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLIKGDKQGKPMACSEDKEYTAK
NGDDYVLSYCYSID
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaatatgctgaacttcgataaaaaagagatgcaacaacaacaacgcccattt
atcgctgaagccgtatttgccgtcgaagcggtaagtgctgagcagcagagtgagaaacaa
gtaaaagcgaagcaactactagaccgcatgttcccattggagagcgggtcgcaccaagat
gtatcaagttacgtgattgattaccgccatgttttggcttatttcaaagacggtacacac
agcggcctgaaaagcccaaaacacttcgtggcgtacactggtgaaaaggaagacccaaaa
tcgatcttgttcaaagatgattcaggcaaccacgtagaagtgctgtttggttgccataaa
ggcacaggttgtgtggagttaatggacatcgatgacatccaattggaaactcgcattacg
ttcaatccagagctgacaggcaatgcgccaaccgcgatgcgtcattggatcagtcttatc
aaaggcgataagcaaggcaagccgatggcgtgtagcgaagacaaagagtacaccgcaaaa
aatggtgacgactatgttcttagttactgctacagcattgattaa

DBGET integrated database retrieval system