KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0201Help
Entry
VPA0201           CDS       T00120                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00620  Pyruvate metabolism
vpa00630  Glyoxylate and dicarboxylate metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01200  Carbon metabolism
Module
vpa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPA0201
   00630 Glyoxylate and dicarboxylate metabolism
    VPA0201
Enzymes [BR:vpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VPA0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CX
Motif
Other DBs
NCBI-GeneID: 1190889
NCBI-ProteinID: NP_799711
UniProt: Q87JP7
Position
II:202416..203000
Genome map
AA seq 194 aa AA seqDB search
MTMNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLESGSHQD
VSSYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDDSGNHVEVLFGCHK
GTGCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLIKGDKQGKPMACSEDKEYTAK
NGDDYVLSYCYSID
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaatatgctgaacttcgataaaaaagagatgcaacaacaacaacgcccattt
atcgctgaagccgtatttgccgtcgaagcggtaagtgctgagcagcagagtgagaaacaa
gtaaaagcgaagcaactactagaccgcatgttcccattggagagcgggtcgcaccaagat
gtatcaagttacgtgattgattaccgccatgttttggcttatttcaaagacggtacacac
agcggcctgaaaagcccaaaacacttcgtggcgtacactggtgaaaaggaagacccaaaa
tcgatcttgttcaaagatgattcaggcaaccacgtagaagtgctgtttggttgccataaa
ggcacaggttgtgtggagttaatggacatcgatgacatccaattggaaactcgcattacg
ttcaatccagagctgacaggcaatgcgccaaccgcgatgcgtcattggatcagtcttatc
aaaggcgataagcaaggcaagccgatggcgtgtagcgaagacaaagagtacaccgcaaaa
aatggtgacgactatgttcttagttactgctacagcattgattaa

DBGET integrated database retrieval system