KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0201Help
Entry
VPA0201           CDS       T00120                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vpa01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vpa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:202416..203000
Genome map
AA seq 194 aa AA seqDB search
MTMNMLNFDKKEMQQQQRPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLESGSHQD
VSSYVIDYRHVLAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDDSGNHVEVLFGCHK
GTGCVELMDIDDIQLETRITFNPELTGNAPTAMRHWISLIKGDKQGKPMACSEDKEYTAK
NGDDYVLSYCYSID
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaatatgctgaacttcgataaaaaagagatgcaacaacaacaacgcccattt
atcgctgaagccgtatttgccgtcgaagcggtaagtgctgagcagcagagtgagaaacaa
gtaaaagcgaagcaactactagaccgcatgttcccattggagagcgggtcgcaccaagat
gtatcaagttacgtgattgattaccgccatgttttggcttatttcaaagacggtacacac
agcggcctgaaaagcccaaaacacttcgtggcgtacactggtgaaaaggaagacccaaaa
tcgatcttgttcaaagatgattcaggcaaccacgtagaagtgctgtttggttgccataaa
ggcacaggttgtgtggagttaatggacatcgatgacatccaattggaaactcgcattacg
ttcaatccagagctgacaggcaatgcgccaaccgcgatgcgtcattggatcagtcttatc
aaaggcgataagcaaggcaagccgatggcgtgtagcgaagacaaagagtacaccgcaaaa
aatggtgacgactatgttcttagttactgctacagcattgattaa

DBGET integrated database retrieval system