KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0202Help
Entry
VPA0202           CDS       T00120                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(203126..204139)
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNFEMDEVLEHYGICP
PAANKQLYNNYVASRAETSLEDLKTNVEVLLHEVSSSMSDTLSDTSSFSAMVDKSFNKLE
KVEDNSLSIEEVMVVIRQLVAESHEIRHSTKFLNRQLTNASEEISRLKHQLAEVQKDALF
DGLSNLYNRRAFDTDLSMLINANQAMTLILLDIDHFKAFNDNYGHLFGDTVLKAIARRLQ
QSCRDGVSAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRVRDKRSGTQVHSITAS
FGVAEFEVGDTVDSLVNKADKQLYEAKQLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagtttaagaaatcgaccgctaacttaaaaaaagcggtgccactaatgatc
aaaaatcatgtagctgccacccccgcaaactacgcgctttggtatacctacgtagacaaa
accattccagaactcaattttgagatggacgaagtgttagaacactatggtatttgtcca
ccagcagcgaacaaacagctttacaacaactacgtggccagtagagcagaaaccagttta
gaagatctcaaaaccaacgtagaagtgctattgcatgaagtgtcgagctccatgagtgat
actttgtcagatacctcttctttctctgcgatggtcgataaaagcttcaacaaattagaa
aaagttgaagacaacagcttgagcatcgaagaagtgatggtggtgatccgccaactcgtt
gctgaatctcatgagattcgccactcaactaaattcttaaaccgccaactcaccaatgcg
agtgaagaaatttctcgtttgaagcatcaattagccgaagtacaaaaagacgcgctgttt
gatggactctctaatctttacaatcgtcgtgcctttgatactgatttgagcatgctgatt
aacgctaatcaggcgatgactctcatcttgctggatatcgaccactttaaagcgtttaac
gataactatgggcacctatttggtgacacagtattgaaagcgatcgcgcgtcgactgcaa
cagagctgtcgcgatggcgtgagtgcataccgcttcggcggcgaagaatttgcgttaatt
gtgccaaacaaatccctacgaatcgcccgccaatatgcagataccctgcgccgcatgatt
gaaaagctgcgtgttcgtgataaacgctcgggcacacaagttcatagcattaccgcttct
tttggtgtggcagagttcgaagttggtgacaccgtagattcattagtcaacaaagccgat
aaacagctttatgaagcaaaacagctcggtcgaaaccgagtgatgcctatctaa

DBGET integrated database retrieval system