KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0307Help
Entry
VPA0307           CDS       T00120                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VPA0307
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     VPA0307
    3.5.1.-  
     VPA0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(307098..307751)
Genome map
AA seq 217 aa AA seqDB search
MTVRVNYQTTAVIDVDPEKGFSELCPDELPVAGALDIVPELLKNHAKGRLKLVSRDLHPP
KAAWDAETPANMLEPVGLPNVDVKWNRHCVLGTTGVELLDGLPPVLDYDFQVNKGMDPDA
HPYGIFFHDVADTKTTGANEFLKCNKIDTVVVGGLALDFCVKKSVMQALDLGFKVIVNLA
ATRAVLPDTVDSVIAEMKEKGALFVKNADDIIVERFA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcgagttaactatcaaactacagccgtgatcgacgttgatccagagaaaggc
tttagtgagctttgtccagatgaattacctgtagcaggcgcattggacatcgtgccggag
ctactaaaaaaccatgcgaaaggtcgcttgaagctagtaagccgtgacttgcacccaccc
aaagccgcttgggatgcagaaacgcccgcgaacatgctagagcccgttggcttgccaaat
gtcgacgtaaaatggaatcgccactgtgtgcttggcacaacaggcgtagagcttctggat
gggttacctccagtgcttgactacgatttccaagtcaataaagggatggatccggacgcg
catccttacggtatcttcttccatgacgtggctgacaccaaaactacgggcgcaaatgag
tttctgaaatgcaataaaatagataccgtcgtagttggtggattagcgctcgatttctgc
gtcaagaaatccgttatgcaagcgttagatctcggctttaaggtgattgtgaatctagct
gcaactcgcgccgttctgccagatacggtcgacagcgtgatcgcagagatgaaagaaaaa
ggcgcactgtttgtcaaaaatgccgatgacattattgttgagcgcttcgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system