KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0446Help
Entry
VPA0446           CDS       T00120                                 

Definition
methylamine utilization protein MauG
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VPA0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:436280..437515
Genome map
AA seq 411 aa AA seqDB search
MKAWLLVMFASFQVSAMSLDETLRVAIQAFELEGNVCSKPLVKEPSYLADVGKVVFERPV
LSGDKDTACANCHLDNKALTDGLPLAIGVGGIGEGEERLASDGAVVPRNAFTLFARGDSR
FNTFFWDGKVQAIDGKIFSPVGEGSSLGFDSALAVAAVLPLLARDEFLGTSKRFNTNRHV
DLVESQYYADKVPAQNTFIQERLLEKNDPDVRMLLAAMESANIPQADLTLPLVGNALASF
IRQKVSEECTPSAWEQYINGDTSALSEVQKRGAILFYGKARCASCHSGDLMSDMSFHSIG
VPQGNQGPHMFGQDFGRALVTLDNSDRYAFRTPSLVAVSKTAPYGHNGIFPTLKGVVKHH
ISPIFYYRDPTVSDQMILDNNESLDRRSDMLRWIRVDESELSQLLTFLDAL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcctggcttcttgttatgtttgcgtcattccaggttagcgccatgtctctggat
gagacattaagggtggctattcaagcgtttgagcttgaagggaatgtttgttcaaagccg
ttggtgaaagaaccttcgtatttggcagatgtgggcaaagtggtttttgaacgccctgtg
ttgagtggggataaggacactgcttgtgctaattgccatcttgataacaaggcactcact
gatgggctacctttagcgattggtgttggagggataggtgaaggtgaggagaggttagct
agtgatggcgcagttgtgccgcgtaacgcttttactctttttgctcggggtgatagccga
ttcaatacgttcttttgggatggtaaggttcaagctattgacggaaagattttttcaccc
gttggcgaggggagctcgttgggctttgattctgcgctcgctgttgcggcagttttacca
ctgttggctcgtgacgagtttctcgggaccagtaaacgattcaataccaatcggcatgtc
gacctagttgagtcacaatactatgctgacaaggtgcctgctcaaaataccttcattcaa
gaaaggctactcgaaaaaaatgatcctgatgttcgaatgctgctggccgcaatggaatct
gccaacatacctcaggcagacctgacgttacctttggttggtaatgcattggcaagcttc
ataaggcagaaggtcagtgaggagtgtacgccttcagcttgggaacaatacataaatggc
gatacgtctgcattgtcagaagtgcaaaaacgcggtgccatacttttttatggtaaggcg
cgttgtgcttcttgtcattctggggacttaatgagtgatatgtcgtttcattcaattggt
gttcctcagggaaatcaaggcccccacatgtttggacaagattttggtcgagcactggtg
actctggacaacagtgatagatatgcgtttagaacgccttcattggtagcggtatctaaa
acggctccatatggacataatggtatttttcctacattgaaaggggtggttaagcatcat
atcagtcccattttctactatcgggatccgacagtctccgatcaaatgattctcgataat
aatgaatcgctggacagacgcagtgacatgctacgctggattagagtggatgaaagtgag
cttagtcagttgctgacatttctggatgccctgtag

DBGET integrated database retrieval system