KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0707Help
Entry
VPA0707           CDS       T00120                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vpa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vpa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(733331..734455)
Genome map
AA seq 374 aa AA seqDB search
MNQNKPPFIWLNILIFSASFVLTFIVMPWYAYHYGLGWEHLIWGILAFSFTNLSITAGYH
RLWSHKTYEAHPVLRAIFAIGGAFSLQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWY
SHIGWMLRDYNKSKENEYTNCRDLKRDSIVMWQHNYYVPLALLTNIGFPVALGLIYGDVW
GMLLVVGAARLFLSHHTTFFINSLAHVWGKQTFTDKNTARDNGVLAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTSTFRIEKARATQLLKKAKEKLESK
PNAQTVLDQLQQEFDALVHHMQEYYEARKELLGEKTANVVKKYECSVSKLKYQQLKTEFE
RQQRSWNLMIRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaaacaaaccaccatttatctggttgaatatattgattttttcagccagtttt
gttctaacgtttattgtaatgccttggtacgcatatcattatggactgggctgggagcac
ttgatttggggtatccttgcattcagtttcactaacctatcgattactgcgggatatcat
cgcctttggagccataaaacttacgaagctcatcctgtattacgtgcaattttcgcgatt
ggcggcgctttttctctccaaaacagtgcattacactggtcttctgatcaccgagtgcat
cacaaacatgtcgataacaatgacaaagatccctactccgccaaacgtggcttttggtat
tcacatattggctggatgttgcgcgactacaataagtctaaagaaaatgagtacaccaat
tgccgcgatctaaaacgcgatagcattgtgatgtggcaacacaactactatgtgccgtta
gctttgctgactaatatcggtttccctgtagctttgggtcttatctatggggatgtttgg
ggaatgctgcttgttgttggcgcagctcgcctgttcttgagccatcacacaaccttcttt
attaactctttggcgcatgtttggggcaagcaaacttttacggacaaaaatacggcccgc
gataacggtgtcttagccttctttacctttggcgagggttaccacaattttcaccacatc
tttgagaatgactaccgcaatggtgtttattggtggcactacgatccaactaaatggctg
atcaagtcttgttcttggttggggctgacgtccaagcttcgcactacatcaactttccga
attgaaaaagcgcgagcaacccagttgttgaagaaagcgaaagagaaactggagtccaaa
cccaatgcgcaaactgttctcgatcaacttcagcaagagtttgatgcattggttcaccac
atgcaggaatactacgaagcacgcaaagagttgctcggtgagaaaactgcgaacgtagtg
aagaaatacgagtgctctgtatcgaaattgaagtatcaacaacttaaaaccgagtttgag
cgtcaacaacgtagttggaacttgatgatccgtcgttacgcataa

DBGET integrated database retrieval system